DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT76E2

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_200767.1 Gene:UGT76E2 / 836078 AraportID:AT5G59590 Length:449 Species:Arabidopsis thaliana


Alignment Length:492 Identity:120/492 - (24%)
Similarity:188/492 - (38%) Gaps:126/492 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ILAVYPHFGFSHFKVVMPILNELAHRGHDITVISYVKNPQAGAYPNYEELLISAPGEDQSSTTIN 93
            :|...|..|  |...:|.:...|..:|..|||:....|..:.:....:...::.||....|...|
plant    12 VLVPVPAQG--HVTPMMQLGKALHSKGFSITVVLTQSNRVSSSKDFSDFHFLTIPGSLTESDLQN 74

  Fly    94 LVP---------LTEHTPTRSLGVLIREYVDLHEEGQKTCEHLFASGHIERAIERHRNKPYDLLL 149
            |.|         :.|.:..:.:|.|      |||:    |.:..|.            ..||..:
plant    75 LGPQKFVLKLNQICEASFKQCIGQL------LHEQ----CNNDIAC------------VVYDEYM 117

  Fly   150 TEYFNSDCQLALAKLLNLPIIGLSTCALMPYYYDRIDLPDTPAFIQSEFVGFAGQLNWHERLLNF 214
              ||:.    |..|...||.:..||.:             ..||:....:   .::|....|::.
plant   118 --YFSH----AAVKEFQLPSVVFSTTS-------------ATAFVCRSVL---SRVNAESFLIDM 160

  Fly   215 ----VQAKLLKFLY--KYHSNRADNELVRKYLG-----VEVDVEEV-ARTQTAFIFGNQ---HYS 264
                .|.|:...|:  :|      .:|.....|     ::|..|.| .||.:|.|..:.   ..|
plant   161 KDPETQDKVFPGLHPLRY------KDLPTSVFGPIESTLKVYSETVNTRTASAVIINSASCLESS 219

  Fly   265 LMGSRPQSLQ--FVEIGGVHITKKAEQEL---PQNIANFLN-QSAEGVIFISWGSMVRASSIDED 323
            .:....|.||  ...||.:|||..|...|   .::...:|| |.:..||:||.||:....:.|  
plant   220 SLARLQQQLQVPVYPIGPLHITASAPSSLLEEDRSCVEWLNKQKSNSVIYISLGSLALMDTKD-- 282

  Fly   324 KLSAILEVL-----KSQPLKIIWKWEADETPDTDASKFL-------------FVKWAPQLALLCH 370
                :||:.     .:||  .:|.......|.::.::.|             .||||||:.:|.|
plant   283 ----MLEMAWGLSNSNQP--FLWVVRPGSIPGSEWTESLPEEFNRLVSERGYIVKWAPQMEVLRH 341

  Fly   371 PKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQFLNA---FSVQNRGMGLKLDYQDITVPNLKK 432
            |.|..||||.|...|.||:..|.|::..|..|||.:||   ..|...|:.|:.|....||....:
plant   342 PAVGGFWSHCGWNSTVESIGEGVPMICRPFTGDQKVNARYLERVWRIGVQLEGDLDKETVERAVE 406

  Fly   433 AL------AELSKNSYAQRSLEVSKVFNERQQTPLES 463
            .|      ||:.|     |::::    .|:.:|.:.|
plant   407 WLLVDEEGAEMRK-----RAIDL----KEKIETSVRS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 120/492 (24%)
UDPGT 38..501 CDD:278624 117/483 (24%)
UGT76E2NP_200767.1 Glycosyltransferase_GTB-type 1..449 CDD:415824 120/492 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.