DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UF3GT

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_200217.1 Gene:UF3GT / 835489 AraportID:AT5G54060 Length:468 Species:Arabidopsis thaliana


Alignment Length:503 Identity:108/503 - (21%)
Similarity:180/503 - (35%) Gaps:139/503 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LGILGIPEPISAGNILAVYPHFGFSHFKVVMPILNELAHRGHDITVISYVKNPQAGAYPNYEELL 79
            :|:.|..|  |:...:.:||...|.|....:.:.|:||.:||.|..:...|     |....|.| 
plant     1 MGVFGSNE--SSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKK-----ALNQLEPL- 57

  Fly    80 ISAPGEDQSSTTINLVP--LTEHTPTRSLGVLIREYVDLHEEGQKTCEHLFASGHIERAIERHRN 142
                         ||.|  :|.||      :.|.:...|....:...:..|...|: .|:...:.
plant    58 -------------NLYPNLITFHT------ISIPQVKGLPPGAETNSDVPFFLTHL-LAVAMDQT 102

  Fly   143 KPY----------DLLLTEYFNSDCQLAL---AKLLNLPIIGLSTCA--LMPYYYDRI------- 185
            :|.          ||:..:..:...::|.   ||.:...|:..::.|  |:|.....:       
plant   103 RPEVETIFRTIKPDLVFYDSAHWIPEIAKPIGAKTVCFNIVSAASIALSLVPSAEREVIDGKEMS 167

  Fly   186 --DLPDTP-AFIQSEFVGFAGQLNWHERLLNFVQAKLLKFLYKYHSNRADNELVRKYLGVEVD-- 245
              :|..|| .:..|:.|     |..||       ||.|.|:::.|      |.:..:...:|.  
plant   168 GEELAKTPLGYPSSKVV-----LRPHE-------AKSLSFVWRKH------EAIGSFFDGKVTAM 214

  Fly   246 -------VEEVARTQTAFI-FGNQHYS---------LMGSRPQSLQFVEIGGVHITKKAEQELPQ 293
                   :.....|:..|. :.::.||         |.||:|.                :..|..
plant   215 RNCDAIAIRTCRETEGKFCDYISRQYSKPVYLTGPVLPGSQPN----------------QPSLDP 263

  Fly   294 NIANFLNQSAEG-VIFISWGSMVRASSIDE-DKLSAILE-------VLKSQPLKIIWKWEADETP 349
            ..|.:|.:...| |:|.::||....:.||: .:|...||       |....|..:....||  .|
plant   264 QWAEWLAKFNHGSVVFCAFGSQPVVNKIDQFQELCLGLESTGFPFLVAIKPPSGVSTVEEA--LP 326

  Fly   350 D-----TDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQFLNAF 409
            :     ......:|..|..|..:|.||.|..|.||.|.....||:.....:::.|.:|:|.||| 
plant   327 EGFKERVQGRGVVFGGWIQQPLVLNHPSVGCFVSHCGFGSMWESLMSDCQIVLVPQHGEQILNA- 390

  Fly   410 SVQNRGMGLKLDYQDITVPNLKKALAELSKNSYAQRSLE--VSKVFNE 455
                   .|..:..::.|     .:....|..::::|||  |..|..|
plant   391 -------RLMTEEMEVAV-----EVEREKKGWFSRQSLENAVKSVMEE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 108/503 (21%)
UDPGT 38..501 CDD:278624 102/480 (21%)
UF3GTNP_200217.1 Glycosyltransferase_GTB-type 10..462 CDD:415824 104/492 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.