DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and AT5G38010

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_198617.1 Gene:AT5G38010 / 833780 AraportID:AT5G38010 Length:453 Species:Arabidopsis thaliana


Alignment Length:461 Identity:103/461 - (22%)
Similarity:152/461 - (32%) Gaps:149/461 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILGIPEPISAGNILAVYPHFGFSHFKVVMPILNELAHRGHDITV----ISYVKNPQAGAYPNYEE 77
            |:.||.|..             .|...:|.:...|..:|..|||    .:|:|..:..|...:..
plant    11 IVLIPAPAQ-------------GHISPMMQLARALHLKGFSITVAQTKFNYLKPSKDLADFQFIT 62

  Fly    78 LLISAPGEDQSSTTINLVPL---------TEHTPTRSLGVLIREYVDLHEEGQKTCEHLFASGHI 133
            :..|.|..|..    ||.|:         .|.:....||.|:.:...:.|| :..|.......:.
plant    63 IPESLPASDLK----NLGPVWFLLKLNKECEFSFKECLGQLLLQKQLIPEE-EIACVIYDEFMYF 122

  Fly   134 ERAIERHRNKPYDLLLTEYFNS-DCQLALAKLLNLPIIGLST----CA--------LMPYYYDRI 185
            ..|..:..|.|..:..||...: .|:.|:.||....  ||:.    |.        |.|..|.  
plant   123 AEAAAKEFNLPKVIFSTENATAFACRSAMCKLYAKD--GLAPLKEGCGREEELVPKLHPLRYK-- 183

  Fly   186 DLPDTPAFIQSEFVGFAGQLNWHERLLNFVQAKLLKFLYKYHSNRADNELVRKYLGVEVDVEEVA 250
            ||| |.||..                   |:|.:..|........|...::.....:|:...|..
plant   184 DLP-TSAFAP-------------------VEASVEVFKSSCDKGTASAMIINTVRCLEISSLEWL 228

  Fly   251 RTQTAFIFGNQHYSLMGSRPQSLQFVEIGGVHITKKA-------EQELPQNIANFLN-QSAEGVI 307
            :.:.                 .:....||.:|:...|       |.|   :..::|| |....||
plant   229 QQEL-----------------KIPIYPIGPLHMVSSAPPTSLLDENE---SCIDWLNKQKPSSVI 273

  Fly   308 FISWGS-------------------------MVRASSI------DEDKLSAILEVLKSQPLKIIW 341
            :||.||                         ::|..||      :|:.||.:             
plant   274 YISLGSFTLLETKEVLEMASGLVSSNQHFLWVIRPGSILGSELTNEELLSMM------------- 325

  Fly   342 KWEADETPDTDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQFL 406
                 |.||    :...||||||..:|.|..|..||||.|...|.||:..|.|::..|...||.:
plant   326 -----EIPD----RGYIVKWAPQKQVLAHSAVGAFWSHCGWNSTLESMGEGVPMICRPFTTDQKV 381

  Fly   407 NAFSVQ 412
            ||..|:
plant   382 NARYVE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 103/461 (22%)
UDPGT 38..501 CDD:278624 99/440 (23%)
AT5G38010NP_198617.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 103/461 (22%)
YjiC 8..433 CDD:224732 103/461 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.