DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT72E3

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_198003.1 Gene:UGT72E3 / 832700 AraportID:AT5G26310 Length:481 Species:Arabidopsis thaliana


Alignment Length:485 Identity:99/485 - (20%)
Similarity:177/485 - (36%) Gaps:145/485 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AVYPHFGFSHFKVVMPILNELAHR---GHDITVISYVKNPQAGAYPNYEELLISAPGED----QS 88
            |::...|..|   |:|:: |||.|   .|...|..:|....|.   :.:..|:::.|.|    .|
plant     9 AMFSSPGMGH---VLPVI-ELAKRLSANHGFHVTVFVLETDAA---SVQSKLLNSTGVDIVNLPS 66

  Fly    89 STTINLVPLTEHTPTRSLGVLIREYVDLHEEGQKTCEHLFASGHIERAIERHRNKPYDLLLTEYF 153
            .....||....|..|: :||::||.|....               .:.:..|:|.  ..|:.:.|
plant    67 PDISGLVDPNAHVVTK-IGVIMREAVPTLR---------------SKIVAMHQNP--TALIIDLF 113

  Fly   154 NSDCQLALAKLLNLPIIGLSTCAL---MPYYYDRID----------------------------- 186
            .:|.....|:|..|..:.:::.|.   :..||..:|                             
plant   114 GTDALCLAAELNMLTYVFIASNARYLGVSIYYPTLDEVIKEEHTVQRKPLTIPGCEPVRFEDIMD 178

  Fly   187 ---LPDTPAFIQSEFVGFAGQLNWHERLLNFVQAKLLKFLYKYHSNRADNELVRKYLGVEVDVEE 248
               :||.|.:              |:         |::....|  .:||..||..:  .|::.:.
plant   179 AYLVPDEPVY--------------HD---------LVRHCLAY--PKADGILVNTW--EEMEPKS 216

  Fly   249 VARTQTAFIFGNQHYSLMGSRPQSLQFVEIGGV-HITKKAEQELPQNIANFLN-QSAEGVIFISW 311
            :...|...:.|         |...:....:|.: ...:.:..:.|  :.::|| |..|.|::||:
plant   217 LKSLQDPKLLG---------RVARVPVYPVGPLCRPIQSSTTDHP--VFDWLNKQPNESVLYISF 270

  Fly   312 GSMVRASSIDEDKLSAILEVLKSQPLKIIWKWE-------------------ADETPD------- 350
            ||   ..|:...:|:.:...|:....:.||...                   .|.||:       
plant   271 GS---GGSLTAQQLTELAWGLEESQQRFIWVVRPPVDGSSCSDYFSAKGGVTKDNTPEYLPEGFV 332

  Fly   351 --TDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQFLNAFSVQN 413
              |....|:...||||..:|.|..|..|.:|.|...|.|||.||.|::..|::.:|.:||..:.:
plant   333 TRTCDRGFMIPSWAPQAEILAHQAVGGFLTHCGWSSTLESVLCGVPMIAWPLFAEQNMNAALLSD 397

  Fly   414 R-GMGLKLDYQDITVPN------LKKALAE 436
            . |:.:::|.....:..      ::|.:||
plant   398 ELGISVRVDDPKEAISRSKIEAMVRKVMAE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 99/485 (20%)
UDPGT 38..501 CDD:278624 97/478 (20%)
UGT72E3NP_198003.1 PLN02992 1..481 CDD:178572 99/485 (20%)
YjiC 5..442 CDD:224732 99/485 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.