DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:456 Identity:98/456 - (21%)
Similarity:168/456 - (36%) Gaps:137/456 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EPISAGNILAVYPHFGFSHFKVVMPILNELAHRGHDITVISYVKNPQAGAYPNYEELLISAPGED 86
            :|....::..:...|| :|...::.:...||..... ||.|:....|:.:      .|.|:..|.
plant     6 DPTRDSHVAVLAFPFG-THAAPLLTVTRRLASASPS-TVFSFFNTAQSNS------SLFSSGDEA 62

  Fly    87 QSSTTINLVPLTEHTPTRSLGVLIREYVDLHEEGQKTCEHLFASGHIERAIERHRNKPYDLLL-- 149
            .....|.:..:.:..|                ||     ::| ||..:.|||        |.|  
plant    63 DRPANIRVYDIADGVP----------------EG-----YVF-SGRPQEAIE--------LFLQA 97

  Fly   150 -TEYFNSDCQLALAKLLNLPIIGLSTCALM--PYYYDRIDLPDTPAFIQSEFVGF----AGQLNW 207
             .|.|..:...|..:      :|.....||  .:::...|:...   |.:.::.|    |..|:.
plant    98 APENFRREIAKAETE------VGTEVKCLMTDAFFWFAADMATE---INASWIAFWTAGANSLSA 153

  Fly   208 HERLLNFVQAKLLKFLYKYHSNRADNELVRKYLGV-EVD--VEE------------VARTQTAFI 257
            |              ||        .:|:|:.:|| ||.  :||            |..|....:
plant   154 H--------------LY--------TDLIRETIGVKEVGERMEETIGVISGMEKIRVKDTPEGVV 196

  Fly   258 FGN--QHYSLM----------------------------GSRPQSLQFVEIGGVHITKKAEQELP 292
            |||  ..:|.|                            ..|.:..:::.||.:.:.....|:|.
plant   197 FGNLDSVFSKMLHQMGLALPRATAVFINSFEDLDPTLTNNLRSRFKRYLNIGPLGLLSSTLQQLV 261

  Fly   293 QN----IANFLNQSAEGVIFISWGSMVRASSIDEDKLSAILEVLKSQPLKIIWKWEAD---ETP- 349
            |:    :|....:|:..|.:||:|:::   :....:|:||.|.|:|..:..:|..:..   :.| 
plant   262 QDPHGCLAWMEKRSSGSVAYISFGTVM---TPPPGELAAIAEGLESSKVPFVWSLKEKSLVQLPK 323

  Fly   350 ---DTDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQFLNAFSV 411
               |....:.:.|.||||:.||.|....:|.:|.|.....|||..|.|::..|.:|||.||..:|
plant   324 GFLDRTREQGIVVPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAV 388

  Fly   412 Q 412
            :
plant   389 E 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 98/456 (21%)
UDPGT 38..501 CDD:278624 95/440 (22%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 97/450 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.