DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:333 Identity:78/333 - (23%)
Similarity:126/333 - (37%) Gaps:109/333 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LTEHTPTRSLGVLIREYVDLHEEGQKTCEHL-FASGHIERAIERHRNKP------YDLLLTEYFN 154
            ||.|..|.:    |||.|.:.|.|::..|.: |.||     :|:.|.|.      :..|.:.:..
plant   148 LTAHLYTDA----IRENVGVKEVGERMEETIGFISG-----MEKIRVKDTQEGVVFGNLDSVFSK 203

  Fly   155 SDCQLALAKLLNLPIIGLSTCALMPYYYDRIDLPDTPAF---IQSEFVGFAGQLNWHERLLNFVQ 216
            :..|:.||    ||    ...|:....::.:|    |.|   .:|||          :|.||...
plant   204 TLHQMGLA----LP----RATAVFINSFEELD----PTFTNDFRSEF----------KRYLNIGP 246

  Fly   217 AKLLKFLYKYHSNRADNELVRKYLGVEVDVEEVARTQTAFIFGNQHYSLMGSRPQSLQFVEIGGV 281
            ..||.                            :.:||:.:..:.|        ..|.::|    
plant   247 LALLS----------------------------SPSQTSTLVHDPH--------GCLAWIE---- 271

  Fly   282 HITKKAEQELPQNIANFLNQSAEGVIFISWGSMVRASSIDEDKLSAILEVLKSQPLKIIW---KW 343
                              .:|...|.:|::|.:.....::   |.||.:.|:|..:..:|   :.
plant   272 ------------------KRSTASVAYIAFGRVATPPPVE---LVAIAQGLESSKVPFVWSLQEM 315

  Fly   344 EADETP----DTDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQ 404
            :....|    |....:.:.|.||||:.||.|..:.:|.||||.....|||..|.|::..||:||.
plant   316 KMTHLPEGFLDRTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDH 380

  Fly   405 FLNAFSVQ 412
            .:||.||:
plant   381 AINARSVE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 78/333 (23%)
UDPGT 38..501 CDD:278624 78/333 (23%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 78/333 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.