DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:522 Identity:119/522 - (22%)
Similarity:179/522 - (34%) Gaps:172/522 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LNELAH-RGHDITVISYVKN-PQAGAYPNYEELLISAPGEDQSSTTINLVPLTEHTPTRSLGVLI 110
            |.::.| ||..||||....| |:|.::|.:..:.|    :|..|.|        .|.||.:.:||
plant    26 LAKILHSRGFSITVIHTCFNAPKASSHPLFTFIQI----QDGLSET--------ETRTRDVKLLI 78

  Fly   111 -----------REYV-----DLHEEGQKTCEHLFASGHIERAIERHRNKPYDLLLTEYFNSDCQL 159
                       ||.:     ...||.|:....:..||.|               .|::       
plant    79 TLLNQNCESPVRECLRKLLQSAKEEKQRISCLINDSGWI---------------FTQH------- 121

  Fly   160 ALAKLLNLPIIGLSTCALMPYYYDRIDLPDTPAFIQSEFVGFAGQLNWHERLLNFVQAKLLKFLY 224
             |||.|||..:..:|..:              :|.:|.||              ..|.:...||.
plant   122 -LAKSLNLMRLAFNTYKI--------------SFFRSHFV--------------LPQLRREMFLP 157

  Fly   225 KYHSNRAD----------NELVRKYLGVEVD----------VEEVARTQTAFIFGN----QHYSL 265
            ...|.:.|          .:|:|.   :|.|          :.|..:..:..||.:    ...||
plant   158 LQDSEQDDPVEKFPPLRKKDLLRI---LEADSVQGDSYSDMILEKTKASSGLIFMSCEELDQDSL 219

  Fly   266 MGSRPQ-SLQFVEIGGVHITKKAEQELPQNIANFL-----------NQSAEGVIFISWGSMVRAS 318
            ..||.. .:....||..|      ...|.:.::..           .|..:.||::|.||:|   
plant   220 SQSREDFKVPIFAIGPSH------SHFPASSSSLFTPDETCIPWLDRQEDKSVIYVSIGSLV--- 275

  Fly   319 SIDEDKLSAILEVLKSQPLKIIWKWEADETPDTD-------------ASKFLFVKWAPQLALLCH 370
            :|:|.:|..|...|.:.....:|.........|:             ..|...||||||..:|.|
plant   276 TINETELMEIAWGLSNSDQPFLWVVRVGSVNGTEWIEAIPEYFIKRLNEKGKIVKWAPQQEVLKH 340

  Fly   371 PKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQFLNAFSVQNRGM-GLKLDYQDITVPNLKKAL 434
            ..:..|.:|.|...|.|||..|.|::..|...||.|||..|.:..| |:.|:.: |....:::|:
plant   341 RAIGGFLTHNGWNSTVESVCEGVPMICLPFRWDQLLNARFVSDVWMVGIHLEGR-IERDEIERAI 404

  Fly   435 AELSKNSYAQRSLEV-SKVFNERQQTPLESAIWSVEHVISNGLIAARLLQSPGIELNGFVYHSLD 498
            ..|        .||. .:...||.|...|....||:.                   ||..|.||.
plant   405 RRL--------LLETEGEAIRERIQLLKEKVGRSVKQ-------------------NGSAYQSLQ 442

  Fly   499 SV 500
            ::
plant   443 NL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 114/495 (23%)
UDPGT 38..501 CDD:278624 119/522 (23%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 119/522 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.