DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT84A3

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_193284.1 Gene:UGT84A3 / 827221 AraportID:AT4G15490 Length:479 Species:Arabidopsis thaliana


Alignment Length:382 Identity:78/382 - (20%)
Similarity:154/382 - (40%) Gaps:106/382 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 HLFASG--HIERAIERHRNKPYDLLLTEYFNS-DCQLALAKLLNLP--IIGLSTCALMP---YYY 182
            ||.|.|  .|:..::|:..:|...|:...|.. .|.  :|:.|::|  ::.:.:||.:.   ||:
plant    94 HLEAVGKQEIKNLVKRYNKEPVTCLINNAFVPWVCD--VAEELHIPSAVLWVQSCACLTAYYYYH 156

  Fly   183 DR-------------IDLP--------DTPAFI--QSEFVGFAGQLNWHERLLNFVQAKLLKFLY 224
            .|             :::|        :.|:|:  .|.:..| |.:             :|..|.
plant   157 HRLVKFPTKTEPDISVEIPCLPLLKHDEIPSFLHPSSPYTAF-GDI-------------ILDQLK 207

  Fly   225 KYHSNRADNELVRKYLGVEVDVEEVARTQTAFIFGNQHYSLMGSRPQSLQFVEIGGVHITKKAEQ 289
            ::.::::....:..:..:|.|:.:             |.|.:  .||::    |..|....|..|
plant   208 RFENHKSFYLFIDTFRELEKDIMD-------------HMSQL--CPQAI----ISPVGPLFKMAQ 253

  Fly   290 ELPQNIANFLNQSA------------EGVIFISWGSMVRASSIDEDKLSAILEVLKSQPLKIIWK 342
            .|..::...:::.|            ..|::||:|::   :::.::::..|...:.|..|.::|.
plant   254 TLSSDVKGDISEPASDCMEWLDSREPSSVVYISFGTI---ANLKQEQMEEIAHGVLSSGLSVLWV 315

  Fly   343 ---------WEADETPDTDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVT 398
                     .|....|.....|...|:|.||..:|.||.:..|.||.|...|.|::..|.|::..
plant   316 VRPPMEGTFVEPHVLPRELEEKGKIVEWCPQERVLAHPAIACFLSHCGWNSTMEALTAGVPVVCF 380

  Fly   399 PIYGDQFLNAFSVQNRGMGLKLDYQDI--TVPNLKKALAE---LSKNSYAQRSLEVS 450
            |.:|||..:|..:           .|:  |...|.:..||   :|:...|::.||.:
plant   381 PQWGDQVTDAVYL-----------ADVFKTGVRLGRGAAEEMIVSREVVAEKLLEAT 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 78/382 (20%)
UDPGT 38..501 CDD:278624 78/382 (20%)
UGT84A3NP_193284.1 PLN02555 1..479 CDD:178170 78/382 (20%)
YjiC 8..450 CDD:224732 78/382 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.