DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT84A1

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_193283.2 Gene:UGT84A1 / 827220 AraportID:AT4G15480 Length:490 Species:Arabidopsis thaliana


Alignment Length:398 Identity:92/398 - (23%)
Similarity:160/398 - (40%) Gaps:99/398 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 HLFASG--HIERAIERHR--NKPYDLLLTEYFNS-DCQLALAKLLNLP--IIGLSTCALMPYYYD 183
            ||.:.|  .:.:.:.|:.  |:|...|:...|.. .|.  :|:..|:|  ::.:.:||....||.
plant   104 HLESVGIREVSKLVRRYEEANEPVSCLINNPFIPWVCH--VAEEFNIPCAVLWVQSCACFSAYYH 166

  Fly   184 RID----------------LPDTPAFIQSEFVGFAGQLNWHERLLNFVQAKLLKFLYKYHSNRAD 232
            ..|                ||..|.....|...|   |:...|...|.||.|.:|   .:.:::.
plant   167 YQDGSVSFPTETEPELDVKLPCVPVLKNDEIPSF---LHPSSRFTGFRQAILGQF---KNLSKSF 225

  Fly   233 NELVRKYLGVEVDVEE----------------VARTQTAFIFG------NQHYSLMGSRPQ-SLQ 274
            ..|:..:..:|.:|.:                ||||.|:.:.|      ::....:.|||: |:.
plant   226 CVLIDSFDSLEQEVIDYMSSLCPVKTVGPLFKVARTVTSDVSGDICKSTDKCLEWLDSRPKSSVV 290

  Fly   275 FVEIGGVHITKKAEQELPQNIANFLNQSAEGVIFISWGSMVRASSIDEDKLSAILEVLKSQP--L 337
            ::..|.|...|   ||..:.||:.:.:|  |:.|: |                   |::..|  |
plant   291 YISFGTVAYLK---QEQIEEIAHGVLKS--GLSFL-W-------------------VIRPPPHDL 330

  Fly   338 KIIWKWEADETPDTDA-SKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIY 401
            |:.......|..::.| .|.:.|.|.||..:|.||.|..|.:|.|...|.||:..|.|::..|.:
plant   331 KVETHVLPQELKESSAKGKGMIVDWCPQEQVLSHPSVACFVTHCGWNSTMESLSSGVPVVCCPQW 395

  Fly   402 GDQFLNA-FSVQNRGMGLKLD---YQDITVPNLKKALAELSKNSYAQRSLEVSKVFNERQQTPLE 462
            |||..:| :.:.....|::|.   .::..||          :...|::.||.:  ..|:.:...:
plant   396 GDQVTDAVYLIDVFKTGVRLGRGATEERVVP----------REEVAEKLLEAT--VGEKAEELRK 448

  Fly   463 SAI-WSVE 469
            :|: |..|
plant   449 NALKWKAE 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 92/398 (23%)
UDPGT 38..501 CDD:278624 92/398 (23%)
UGT84A1NP_193283.2 PLN02555 17..490 CDD:178170 92/398 (23%)
YjiC 19..477 CDD:224732 92/398 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.