DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and AT3G55710

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_191130.1 Gene:AT3G55710 / 824737 AraportID:AT3G55710 Length:464 Species:Arabidopsis thaliana


Alignment Length:491 Identity:107/491 - (21%)
Similarity:187/491 - (38%) Gaps:131/491 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ILAVYPHFGFSHFKVVMPILNELAHRGHDITVISYVKN-PQAGAYPNYEELLISAPGEDQSSTTI 92
            |:...|..|  ||..::.:.....:||..:|::....| |....:|.:....|:...|.:..   
plant    10 IMFPLPFTG--HFNPMIELAGIFHNRGFSVTILHTSFNFPDPSRHPQFTFRTITHKNEGEED--- 69

  Fly    93 NLVPL--TEHTPTRSLGVLI---REYV-------DLHEEGQKTC---EHLFASGHIERAIERHRN 142
               ||  :|.:..:.|.|||   ::|.       ::.|.|...|   :.|:  |.....:.:...
plant    70 ---PLSQSETSSGKDLVVLISLLKQYYTEPSLAEEVGEGGTVCCLVSDALW--GRNTEIVAKEIG 129

  Fly   143 KPYDLLLTEYFNSDCQLALAKLL----NLPIIGLSTCALMPYYYDRID-----LP-----DTPAF 193
            ....::.|....:.|......||    .|||.|           .|:|     ||     |.|..
plant   130 VCTMVMRTSGAATFCAYTAFPLLIDKGYLPIQG-----------SRLDELVTELPPLKVKDLPVI 183

  Fly   194 IQSEFVGFAGQLNWHERLLNFVQAKLLKFLYKYHSNRADNELVRKYLGVEVDVEEVARTQTAFIF 258
            ...|..|    ||   |:||                               |:.|.|:..:..::
plant   184 KTKEPEG----LN---RILN-------------------------------DMVEGAKLSSGVVW 210

  Fly   259 GN----QHYSLMGSRPQ-SLQFVEIGGVHITKKAEQELP-----------QNIANFLN-QSAEGV 306
            ..    :.:|||..|.: .:....||..|   |...:||           :.:.::|| |:.:.|
plant   211 NTFEDLERHSLMDCRSKLQVPLFPIGPFH---KHRTDLPPKPKNKDKDDDEILTDWLNKQAPQSV 272

  Fly   307 IFISWGSMVRASSIDEDKLSAILEVLKSQPLKIIW----------KWEADETP----DTDASKFL 357
            :::|:||:   ::|:|::...|...|::..|..:|          :| .:..|    :....:..
plant   273 VYVSFGSL---AAIEENEFFEIAWGLRNSELPFLWVVRPGMVRGTEW-LESLPCGFLENIGHQGK 333

  Fly   358 FVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQFLNA-FSVQNRGMGLKLD 421
            .|||..||..|.||.|..||:|.|...|.||:..|.|::.||.:.||.:|| :.|....:|:.|:
plant   334 IVKWVNQLETLAHPAVGAFWTHCGWNSTIESICEGVPMICTPCFSDQHVNARYIVDVWRVGMMLE 398

  Fly   422 YQDITVPNLKKALAELSKNSYA---QRSLEVSKVFN 454
            ...:....::|.:..:...:.|   :..||:.:..|
plant   399 RCKMERTEIEKVVTSVMMENGAGLTEMCLELKEKAN 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 107/491 (22%)
UDPGT 38..501 CDD:278624 104/482 (22%)
AT3G55710NP_191130.1 Glycosyltransferase_GTB_type 1..454 CDD:299143 107/491 (22%)
YjiC 7..421 CDD:224732 103/476 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.