DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and AT3G46680

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_190252.1 Gene:AT3G46680 / 823821 AraportID:AT3G46680 Length:449 Species:Arabidopsis thaliana


Alignment Length:419 Identity:100/419 - (23%)
Similarity:163/419 - (38%) Gaps:99/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 HFKVVMPILNELAHRGHDITVI--SYVKNPQAGAYPNYEELLISAPGEDQSSTTINLVPLTEHTP 102
            |...:|.:...|..:|..|||:  .:.|...:..:|.::.:.|               |.||..|
plant    20 HVTPMMQLGTALNMKGFSITVVEGQFNKVSSSQNFPGFQFVTI---------------PDTESLP 69

  Fly   103 TRSLGVLIREYVDLHEEGQKTCEHLFASGHIERAIERHRNKPYDLLLTEYFNSDCQLALAKLLNL 167
            ...|..|  ..|:...|..||.|..| ...|.:::.:..|....::..||... |. |.||..||
plant    70 ESVLERL--GPVEFLFEINKTSEASF-KDCIRQSLLQQGNDIACIIYDEYMYF-CG-AAAKEFNL 129

  Fly   168 PIIGLST---------CALMPYYYDR--IDLPDTPAFIQSEFVGFAGQLNWH----------ERL 211
            |.:..||         |.|.....::  :|:.|..  :|...|.....|.:.          :||
plant   130 PSVIFSTQSATNQVSRCVLRKLSAEKFLVDMEDPE--VQETLVENLHPLRYKDLPTSGVGPLDRL 192

  Fly   212 LNFVQAKLLKFLYKYHSNRADNELVRKYLGVEVDVEEVARTQTAFIFGNQHYSLMGSRPQSLQFV 276
            ....:                 |:|.|.....|.:..|...:::.:...||       ...:...
plant   193 FELCR-----------------EIVNKRTASAVIINTVRCLESSSLKRLQH-------ELGIPVY 233

  Fly   277 EIGGVHITKKAEQEL---PQNIANFLN-QSAEGVIFISWGSMVRASSIDEDKLSAILEVLK---- 333
            .:|.:|||..|...|   .::...:|| |....|::||.||:|:..:      ..:||:.:    
plant   234 ALGPLHITVSAASSLLEEDRSCVEWLNKQKPRSVVYISLGSVVQMET------KEVLEMARGLFN 292

  Fly   334 -SQPLKIIW----------KW-EA--DETPDTDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLG 384
             :||  .:|          :| |:  :|.....:.:...||||||:.:|.||.|..||||.|...
plant   293 SNQP--FLWVIRPGSIAGSEWIESLPEEVIKMVSERGYIVKWAPQIEVLGHPAVGGFWSHCGWNS 355

  Fly   385 TTESVHCGKPLLVTPIYGDQFLNAFSVQN 413
            |.||:..|.|::..|.:|:|.|||..:::
plant   356 TLESIVEGVPMICRPFHGEQKLNALCLES 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 100/419 (24%)
UDPGT 38..501 CDD:278624 100/419 (24%)
AT3G46680NP_190252.1 Glycosyltransferase_GTB_type 1..449 CDD:299143 100/419 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.