DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and HYR1

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:386 Identity:78/386 - (20%)
Similarity:134/386 - (34%) Gaps:137/386 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PYYYDRID--LPDTPAFIQSEFVGFAGQLNWHERLLNFVQAKLLKFL-----------YKYHSNR 230
            |:::|.||  .|...|.:  |.:...|..:...||..||.......:           |.::::.
plant    84 PHFFDYIDNFKPQVKATV--EKLTDPGPPDSPSRLAGFVVDMFCMMMIDVANEFGVPSYMFYTSN 146

  Fly   231 ADNELVRKYLGVEVDVEEVARTQTAFIFGNQHYSLMG--------------SRP----------- 270
            |      .:||::|.||        :::..::|.:..              :||           
plant   147 A------TFLGLQVHVE--------YLYDVKNYDVSDLKDSDTTELEVPCLTRPLPVKCFPSVLL 197

  Fly   271 ----------QSLQFVEIGGVHITKKAEQE-------------LP-------------------- 292
                      |:.:|.|..|:.:...||.|             ||                    
plant   198 TKEWLPVMFRQTRRFRETKGILVNTFAELEPQAMKFFSGVDSPLPTVYTVGPVMNLKINGPNSSD 262

  Fly   293 ---QNIANFLN-QSAEGVIFISWGSMVRASSIDEDKLSAILEVLKSQPLKIIWKWEADE------ 347
               ..|..:|: |..:.|:|:.:|||   ....|.:...|...|:....:.:|.....:      
plant   263 DKQSEILRWLDEQPRKSVVFLCFGSM---GGFREGQAKEIAIALERSGHRFVWSLRRAQPKGSIG 324

  Fly   348 TPD--TDASKFL-------------FVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLV 397
            .|:  |:..:.|             .|.||||.|:|.:|.:..|.||.|...|.||:..|.|:..
plant   325 PPEEFTNLEEILPEGFLERTAEIGKIVGWAPQSAILANPAIGGFVSHCGWNSTLESLWFGVPMAT 389

  Fly   398 TPIYGDQFLNAF----------SVQN--RGMGLKLDYQDITVPNLKKALAELSKNSYAQRS 446
            .|:|.:|.:|||          .|:|  ||..:..|.:.:|...:::.:..|.:.....||
plant   390 WPLYAEQQVNAFEMVEELGLAVEVRNSFRGDFMAADDELMTAEEIERGIRCLMEQDSDVRS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 78/386 (20%)
UDPGT 38..501 CDD:278624 78/386 (20%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 78/386 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.