DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT74F2

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_181910.1 Gene:UGT74F2 / 818986 AraportID:AT2G43820 Length:449 Species:Arabidopsis thaliana


Alignment Length:414 Identity:89/414 - (21%)
Similarity:163/414 - (39%) Gaps:118/414 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 IREYV-DLHEEGQKTCEHLFASGHIERAIERHRN---------------------KPYDLLLTEY 152
            |.:|: |....|.||         |...|::|:.                     :.:.|:.|.:
plant    76 IDDYLKDFKTSGSKT---------IADIIQKHQTSDNPITCIVYDAFLPWALDVAREFGLVATPF 131

  Fly   153 FNSDCQLALAKLLN--------LPIIGLSTCALMPYYYDRIDLPDTPAF--IQSEFVGFAGQLNW 207
            |...|.:.....|:        |||..|      |:    ::|.|.|:|  :...:..:...:  
plant   132 FTQPCAVNYVYYLSYINNGSLQLPIEEL------PF----LELQDLPSFFSVSGSYPAYFEMV-- 184

  Fly   208 HERLLNFVQAKLLKFLYKYHSNRADNELVRKYLGV--------EVDVEEVARTQTAF---IFGNQ 261
            .::.:||.:|..:...........:|||..|...|        .:.:::..::.|.:   :|.::
plant   185 LQQFINFEKADFVLVNSFQELELHENELWSKACPVLTIGPTIPSIYLDQRIKSDTGYDLNLFESK 249

  Fly   262 HYSL----MGSRPQ-SLQFVEIGGV-HITKKAEQELPQNIANFLNQSAEGVIFISWGSMVRASSI 320
            ..|.    :.:||| |:.:|..|.: .:|....:||...::||           |:..:||:|  
plant   250 DDSFCINWLDTRPQGSVVYVAFGSMAQLTNVQMEELASAVSNF-----------SFLWVVRSS-- 301

  Fly   321 DEDKL-SAILEVLKSQPLKIIWKWEADETPDTDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLG 384
            :|:|| |..||.:..:                   |.|.:||:|||.:|.:..:..|.:|.|...
plant   302 EEEKLPSGFLETVNKE-------------------KSLVLKWSPQLQVLSNKAIGCFLTHCGWNS 347

  Fly   385 TTESVHCGKPLLVTPIYGDQFLNAFSVQN---RGMGLKLDYQDITVP------NLKKAL-----A 435
            |.|::..|.|::..|.:.||.:||..:|:   .|:.:|.:.:.....      ::|:.:     .
plant   348 TMEALTFGVPMVAMPQWTDQPMNAKYIQDVWKAGVRVKTEKESGIAKREEIEFSIKEVMEGERSK 412

  Fly   436 ELSKNSYAQRSLEVSKVFNERQQT 459
            |:.||....|.|.| |..||...|
plant   413 EMKKNVKKWRDLAV-KSLNEGGST 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 89/414 (21%)
UDPGT 38..501 CDD:278624 89/414 (21%)
UGT74F2NP_181910.1 PLN02173 1..449 CDD:177830 89/414 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.