DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT74D1

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001325305.1 Gene:UGT74D1 / 817732 AraportID:AT2G31750 Length:490 Species:Arabidopsis thaliana


Alignment Length:283 Identity:65/283 - (22%)
Similarity:119/283 - (42%) Gaps:78/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 FLYKYHSNRADNELVR--------KYLGVEVDVEEVARTQTAFIFGNQHYSLMGSRPQSLQFVE- 277
            |||       ||.|.|        :::.|: |::        |...|....|   ..:.||::: 
plant   177 FLY-------DNNLCRPLFELISSQFVNVD-DID--------FFLVNSFDEL---EVEVLQWMKN 222

  Fly   278 ----------IGGVHITKK--AEQELPQNIAN--------FLNQSAEG-VIFISWGSMVRASSID 321
                      |..:::.|:  .:::...|:.|        :|:....| ||::|:||:   :.:.
plant   223 QWPVKNIGPMIPSMYLDKRLAGDKDYGINLFNAQVNECLDWLDSKPPGSVIYVSFGSL---AVLK 284

  Fly   322 EDKLSAILEVLKSQPLKIIWKWEADETPDTDAS-------KFLFVKWAPQLALLCHPKVKLFWSH 379
            :|::..:...||......:|.....||....::       |.|.|.|:|||.:|.|..:..|.:|
plant   285 DDQMIEVAAGLKQTGHNFLWVVRETETKKLPSNYIEDICDKGLIVNWSPQLQVLAHKSIGCFMTH 349

  Fly   380 GGLLGTTESVHCGKPLLVTPIYGDQFLNAFSVQN---RGMGLKLDYQDITVP------------- 428
            .|...|.|::..|..|:..|.|.||..||..:::   .|:.:|.| |:..||             
plant   350 CGWNSTLEALSLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKAD-QNGFVPKEEIVRCVGEVME 413

  Fly   429 NLKKALAELSKNSYAQRSLEVSK 451
            ::.:...|:.||  |:|.:|.::
plant   414 DMSEKGKEIRKN--ARRLMEFAR 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 65/283 (23%)
UDPGT 38..501 CDD:278624 65/283 (23%)
UGT74D1NP_001325305.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.