DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and AT2G30150

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001323694.1 Gene:AT2G30150 / 817567 AraportID:AT2G30150 Length:456 Species:Arabidopsis thaliana


Alignment Length:428 Identity:99/428 - (23%)
Similarity:175/428 - (40%) Gaps:74/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PEPISAGNILAVYPHFGFSHFKVVMPILNELAHRGHDITVISYVKNPQAGAYPNYEELLISAPGE 85
            |:|:...:::|: |..|..|...::.:...|..|..::||...|.....|..           |.
plant     6 PQPLGVRHVVAM-PWPGRGHINPMLNLCKSLVRRDPNLTVTFVVTEEWLGFI-----------GS 58

  Fly    86 DQSSTTINLVPLTEHTPTRSLGVLIR--EYVDLHEEGQKTCEHLFASGHIERAIERHRNKPYDLL 148
            |.....|:...|....|:.    |:|  :::...:......|..|     |:.::|..:.|..::
plant    59 DPKPNRIHFATLPNIIPSE----LVRANDFIAFIDAVLTRLEEPF-----EQLLDRLNSPPTAII 114

  Fly   149 LTEYFNSDCQLALAKLLNLPIIGL-STCALMPYYYDRIDL-------PDTPAFIQ-SEFVGFAGQ 204
            ...|.....::...:  |:|:... :|.|.:...:...||       |..|:..: .|.|.:...
plant   115 ADTYIIWAVRVGTKR--NIPVASFWTTSATILSLFINSDLLASHGHFPIEPSESKLDEIVDYIPG 177

  Fly   205 LNWHERLLNFVQAKLLKFLYKY-HS-----NRADNELVR-KYL----GVEVDVEEVARTQTAFIF 258
            |: ..||.:      |:.|:.| |.     .::..||.: |||    ..|::.:.:....:.|.|
plant   178 LS-PTRLSD------LQILHGYSHQVFNIFKKSFGELYKAKYLLFPSAYELEPKAIDFFTSKFDF 235

  Fly   259 GNQHYSLMGSRPQSLQFVEIGGVHITKKAEQELPQNIANFLNQSAE-GVIFISWGSMVRASSIDE 322
              ..||.....|  |:.:.:|      ...:||  :...:|::..| .|::||.||.:   |:.|
plant   236 --PVYSTGPLIP--LEELSVG------NENREL--DYFKWLDEQPESSVLYISQGSFL---SVSE 285

  Fly   323 DKLSAILEVLKSQPLKIIWKWEADETPDTDA---SKFLFVKWAPQLALLCHPKVKLFWSHGGLLG 384
            .::..|:..::...:|..|.....|....:|   |..:.|.|..||.:|||..:..||:|.|...
plant   286 AQMEEIVVGVREAGVKFFWVARGGELKLKEALEGSLGVVVSWCDQLRVLCHAAIGGFWTHCGYNS 350

  Fly   385 TTESVHCGKPLLVTPIYGDQFLNAFSVQNR---GMGLK 419
            |.|.:..|.|||..|::.||||||..:...   |||::
plant   351 TLEGICSGVPLLTFPVFWDQFLNAKMIVEEWRVGMGIE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 99/428 (23%)
UDPGT 38..501 CDD:278624 94/411 (23%)
AT2G30150NP_001323694.1 PLN02448 11..456 CDD:215247 97/423 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.