DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT73B4

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_179151.2 Gene:UGT73B4 / 816041 AraportID:AT2G15490 Length:484 Species:Arabidopsis thaliana


Alignment Length:509 Identity:98/509 - (19%)
Similarity:180/509 - (35%) Gaps:134/509 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YPHFGFSHFKVVMPILNELAHRGHDITVISYVKNPQAGAYPNYEELLISAPGEDQSSTTINLVPL 97
            :|.....|...::.:....|.||...|:::...|.:....| .|...:..|..:.....:|.   
plant    11 FPFMAHGHMIPLLDMAKLFARRGAKSTLLTTPINAKILEKP-IEAFKVQNPDLEIGIKILNF--- 71

  Fly    98 TEHTPTRSLGV----LIREYVDLHEEGQK---TCEHLFASGHIERAIER--HRNKPYDLLLTEYF 153
                |...||:    ..|::::.:::...   ..:.||::.::::.:|.  ...||..|:...:|
plant    72 ----PCVELGLPEGCENRDFINSYQKSDSFDLFLKFLFSTKYMKQQLESFIETTKPSALVADMFF 132

  Fly   154 ----NSDCQLALAKLLNLPIIGLSTCALMPYYYDRIDLP-------DTPAFIQSEFVGFAGQLNW 207
                .|..::.:.:|:   ..|.|:.||...|..||..|       .||..|.    |..|.:..
plant   133 PWATESAEKIGVPRLV---FHGTSSFALCCSYNMRIHKPHKKVASSSTPFVIP----GLPGDIVI 190

  Fly   208 HERLLNFV--QAKLLKFLYKYHSNRADNELVRKYLGVEVDVEEVARTQTAFIFG---NQHYSLMG 267
            .|...|..  :....||.                       :||..::|: .||   |..|.|..
plant   191 TEDQANVTNEETPFGKFW-----------------------KEVRESETS-SFGVLVNSFYELES 231

  Fly   268 SRPQSLQFVEIGGVHITKKAEQELPQNIAN----------------------FLNQSAEG-VIFI 309
            |      :.:.....:.|||....|.:::|                      :|:....| |:::
plant   232 S------YADFYRSFVAKKAWHIGPLSLSNRGIAEKAGRGKKANIDEQECLKWLDSKTPGSVVYL 290

  Fly   310 SWGSMVRASSIDEDKLSAILEVLKSQPLKIIW---------------KWEADETPDTDASKFLFV 359
            |:||   .:.:..::|..|...|:......||               .|......:.:..|.|.:
plant   291 SFGS---GTGLPNEQLLEIAFGLEGSGQNFIWVVSKNENQVGTGENEDWLPKGFEERNKGKGLII 352

  Fly   360 K-WAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQFLN---------------A 408
            : ||||:.:|.|..:..|.:|.|...|.|.:..|.|::..|:..:||.|               |
plant   353 RGWAPQVLILDHKAIGGFVTHCGWNSTLEGIAAGLPMVTWPMGAEQFYNEKLLTKVLRIGVNVGA 417

  Fly   409 FSVQNRGMGLKLDYQDITVPNLKKALAELSKNSYAQRSLEVSKVFNERQQTPLE 462
            ..:..:|   ||    |:...::||:.|:.....|:.....:|...|..:..:|
plant   418 TELVKKG---KL----ISRAQVEKAVREVIGGEKAEERRLRAKELGEMAKAAVE 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 98/509 (19%)
UDPGT 38..501 CDD:278624 97/504 (19%)
UGT73B4NP_179151.2 PLN03007 1..484 CDD:178584 98/509 (19%)
YjiC 7..465 CDD:224732 98/509 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.