DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT2B10

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001066.1 Gene:UGT2B10 / 7365 HGNCID:12544 Length:528 Species:Homo sapiens


Alignment Length:541 Identity:131/541 - (24%)
Similarity:255/541 - (47%) Gaps:63/541 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAGNILAVYPHFGFSHFKVVMPILNELAHRGHDITVI----SYVKNPQAGA------YP------ 73
            |.|.:|.....  :|.:..:..||.||..|||::||:    |.:.:|...:      ||      
Human    21 SCGKVLVWAAE--YSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTSLTKT 83

  Fly    74 NYEEL---LISAPGEDQSSTTINLVPLT-EHTPTRSLGVLIREYVDLHEEGQKTCEHLFASGHIE 134
            .:|.:   |:....|.|..|.  .:|.: |.....::..:||.:          |:.:.::..:.
Human    84 EFENIIMQLVKRLSEIQKDTF--WLPFSQEQEILWAINDIIRNF----------CKDVVSNKKLM 136

  Fly   135 RAIERHRNKPYDLLLTEYFNSDCQLALAKLLNLPIIGLSTCALMP-YYYDR----IDLPDTPAFI 194
            :.::..|   :|::..:.: ..|...||:|.|:|.:  .:.:..| |.::|    ...|  |:::
Human   137 KKLQESR---FDIVFADAY-LPCGELLAELFNIPFV--YSHSFSPGYSFERHSGGFIFP--PSYV 193

  Fly   195 QSEFVGFAGQLNWHERLLNFVQAKLLKFLYKYHSNRADNELVRKYLGVEVDVEEVARTQTAFIFG 259
            .......:.|:.:.||:.|.:......|.::..:.:..::...:.||....:.|..|....::..
Human   194 PVVMSKLSDQMTFMERVKNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMR 258

  Fly   260 NQHYSLMGSRP--QSLQFVEIGGVHITKKAEQELPQNIANFLNQSAE-GVIFISWGSMVRASSID 321
            |. ::.....|  .::.||  ||:|.  |..:.||:.:..|:..|.| ||:..|.||||  |::.
Human   259 NS-WNFKFPHPFLPNVDFV--GGLHC--KPAKPLPKEMEEFVQSSGENGVVVFSLGSMV--SNMT 316

  Fly   322 EDKLSAILEVLKSQPLKIIWKWEADETPDTDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTT 386
            |::.:.|...|...|.|::|:::.:: ||.........||.||..||.|||.:.|.:|||..|..
Human   317 EERANVIATALAKIPQKVLWRFDGNK-PDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIY 380

  Fly   387 ESVHCGKPLLVTPIYGDQFLNAFSVQNRGMGLKLDYQDITVPNLKKAL-AELSKNSYAQRSLEVS 450
            |:::.|.|::..|::.||..|...::.:|..:::|:..::..:|..|| ..::..||.:..:::|
Human   381 EAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLS 445

  Fly   451 KVFNERQQTPLESAIWSVEHVISNGLIAARLLQSPGIELNGFVYHSLDSVALILLPLILLILVLC 515
            ::.:::...||:.|::.:|.|:.:.  .|:.|:.....|..|.|||||.:..:|..:..::.::.
Human   446 RIQHDQPVKPLDRAVFWIEFVMRHK--GAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIIT 508

  Fly   516 YLCKRNPSKLAHKKVGKKPKR 536
            ..|.....|.|.|  |||.||
Human   509 KCCLFCFWKFARK--GKKGKR 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 112/478 (23%)
UDPGT 38..501 CDD:278624 118/491 (24%)
UGT2B10NP_001066.1 UDPGT 23..524 CDD:278624 126/534 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.