DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and Ugt1a9

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_964006.2 Gene:Ugt1a9 / 394434 MGIID:3576092 Length:528 Species:Mus musculus


Alignment Length:538 Identity:144/538 - (26%)
Similarity:235/538 - (43%) Gaps:71/538 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AGNILAVYPHFGFSHFKVVMPILNELAHRGHDITVISYVKNPQAGAYPNYEELLISAPGEDQSST 90
            ||.:|.| |..| ||:..:..::.:|.||||::.|:....:.|.|...|               .
Mouse    23 AGRLLVV-PMDG-SHWFTMQMVVEKLIHRGHEVVVVIPEVSWQLGKSLN---------------C 70

  Fly    91 TINLVPLTEHTPTRSLGVLIREYVDLHEEGQKTCEHLF-------ASGHIERAIERHRNKPYDLL 148
            |:....:: ||    |..|.||:..|.....||.||..       |.|..|......|:...|..
Mouse    71 TVKTYSIS-HT----LEDLDREFKYLSYTQWKTPEHSIRSFLTGSARGFFELTFSHCRSLFNDKK 130

  Fly   149 LTEYFNSD------------CQLALAKLLNLPIIGLSTCALMPYYYDRIDLPDTPAFIQSEFVGF 201
            |.||....            |.|.:||..:||.:..:......|..:....|..|:::...|..:
Mouse   131 LVEYLKQRFFDAVFLDPFDVCGLIVAKYFSLPSVIFARGVFCDYLEEGAQCPSLPSYVPRLFSKY 195

  Fly   202 AGQLNWHERLLNFV-----QAKLLKFLYKYHSNRADNELVRKYLGVEVDVEEVARTQTAFIFGNQ 261
            ...:.:.||:.|.:     .|....||      |...|:..:.|...|.:.::....:.::. ..
Mouse   196 TDTMTFKERVWNHLIYIEEHAFCSYFL------RTAVEVASEILQTPVTMTDLFSPVSIWLL-RT 253

  Fly   262 HYSLMGSRPQSLQFVEIGGVHITKKAEQELPQNIANFLNQSAE-GVIFISWGSMVRASSIDEDKL 325
            .:.|...||.....|.|||::..:|  :.|.:....::|.|.| |::..|.||||  |.|.|.|.
Mouse   254 DFVLEFPRPVMPNMVFIGGINCLQK--KSLSKEFEAYVNASGEHGIVVFSLGSMV--SEIPEKKA 314

  Fly   326 SAILEVLKSQPLKIIWKWEADETPDTDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVH 390
            ..|.|.|...|..::|::.... |...|...:.|||.||..||.|||.:.|.:|.|..|..|.:.
Mouse   315 MEIAEALGRIPQTVLWRYTGTR-PSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGIC 378

  Fly   391 CGKPLLVTPIYGDQFLNAFSVQNRGMGLKLDYQDITVPNLKKALAELSKN-SYAQRSLEVSKVFN 454
            .|.|:::.|::|||..||..::.||.|:.|:..::|..:|:.||..:..| ||.:..:.:|.:..
Mouse   379 NGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHK 443

  Fly   455 ERQQTPLESAIWSVEHVISNGLIAARLLQSPGIELNGFVYHSLDSVALIL---LPLILLILVLC- 515
            :|...||:.|::.||:|:.:.  .|..|:....:|..:.|||||.:..:|   |.::.::...| 
Mouse   444 DRPIEPLDLAVFWVEYVMRHK--GAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCA 506

  Fly   516 YLCK-----RNPSKLAHK 528
            |.|:     :...|.:||
Mouse   507 YGCRKCFGGKGRVKKSHK 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 128/474 (27%)
UDPGT 38..501 CDD:278624 130/488 (27%)
Ugt1a9NP_964006.2 egt 9..500 CDD:223071 138/512 (27%)
UDPGT 24..519 CDD:278624 140/530 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.