DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and Ugt301D1

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster


Alignment Length:543 Identity:148/543 - (27%)
Similarity:251/543 - (46%) Gaps:65/543 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIIVLLGILGIPEPISAGN-ILAVYPHFGFSHFKVVMPILNELAHRGHDITVISYVKNPQAGAYP 73
            ::|.|:|:|    ...||: ||.:.|....||:..:....|:|..:||.:|.::  .:|....:.
  Fly    11 MLIFLIGLL----EFGAGSRILFMGPFPAPSHWLWLEHFQNDLLRQGHHVTSVN--NHPTKHPHE 69

  Fly    74 NYEELLISAPGEDQSSTTINLVPLTEHTPTRSLGVL--IREYVDLH---EEGQKTCEHLFASGHI 133
            |..|::|| |..|          :.:|.|..::..:  :.::.:|.   ..|..|.||.|....:
  Fly    70 NLTEIIIS-PSFD----------IPKHFPKENIFSMQFVSDFNNLELWWTIGLMTTEHAFKDPKV 123

  Fly   134 ERAIERHRNKPYDLLLTEYFNSDCQLALAKLLNLPIIGLSTCALMPYYYDRIDLPD---TP-AFI 194
            ::.|| .::..|||::.|.|..:..|...|..|.|::.:.|..    |.|.||...   || :.|
  Fly   124 KKLIE-SKDDHYDLVIIEQFFHEAFLMFGKRFNCPVVTIGTMG----YADNIDHAMGILTPWSLI 183

  Fly   195 QSEFVGFAGQLNWHERLLNFVQA-------------KLLKFLYKYHSNRADNELVRKYLGVEVDV 246
            ....:....::.:.:|..|...:             |:.|...||.....:..|..     .:|:
  Fly   184 PHLLLSHTDRMTFGQRAYNAYLSLYDAVMRRWVYLPKMQKLAEKYFQGSIEGPLPN-----VLDL 243

  Fly   247 EEVARTQTAFIFGNQHYSLMGSRPQSLQFVEIGGVHITKKAEQELPQNIANFLNQSAEGVIFISW 311
            |.    ..:.:..|.|.|:...||.....:::||.||.|  .::||.::.|||:.:..|||:.|.
  Fly   244 ER----NISLVLINAHRSIDLPRPSMPGLIDVGGAHIQK--PKQLPTDLQNFLDNATYGVIYFSM 302

  Fly   312 GSMVRASSIDEDKLSAILEVLKSQPLKIIWKWEADETPDTDASKFLFVKWAPQLALLCHPKVKLF 376
            ||.|:::.:.::|.:.||:.......::|||:|.|...|. .|..:..||.||..:|.||.||||
  Fly   303 GSYVKSTDLPQEKTALILKAFGQLKQQVIWKFENDSIGDL-PSNVMIKKWMPQNDILAHPNVKLF 366

  Fly   377 WSHGGLLGTTESVHCGKPLLVTPIYGDQFLNAFSVQNRGMGLKLDYQDITVPNLKKALAELSKN- 440
            .:|||:.||.|.::.|.|:|..|:||||..|.......|....|.:..:|..:|.:.:..|..: 
  Fly   367 ITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNTIKSVREGYARSLVFSKLTTDDLVRNIETLINDP 431

  Fly   441 SYAQRSLEVSKVFNERQQTPLESAIWSVEHVISNGLIAARLLQSPGIELNGFVYHSLDSVALILL 505
            .|.:.:||||:.|.:....||:.|.:.:|::|.:.  .||.|:|.|..:....|..||.:..:||
  Fly   432 QYKRSALEVSQRFRDNPIHPLDEATFWIEYIIRHR--GARHLKSHGAFIPLHQYLLLDVLGCLLL 494

  Fly   506 PLILLILVLCYLCKRNPSKLAHK 528
            ...|.|.:...:.:|     .||
  Fly   495 GAFLAIWLPWRMIRR-----VHK 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 133/488 (27%)
UDPGT 38..501 CDD:278624 132/485 (27%)
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 138/506 (27%)
UDPGT 37..483 CDD:278624 129/477 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48043
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
66.060

Return to query results.
Submit another query.