DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and Ugt2a3

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001129341.1 Gene:Ugt2a3 / 289533 RGDID:1308444 Length:534 Species:Rattus norvegicus


Alignment Length:525 Identity:135/525 - (25%)
Similarity:248/525 - (47%) Gaps:53/525 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SHFKVVMPILNELAHRGHDITVISY--VKNPQAGAYP----NYEELLISAPGEDQSSTTINLVPL 97
            ||:..:..||.|||.|||::||:.|  :...|:...|    |...|..:...|:..:..:||.  
  Rat    34 SHWLNLKTILEELAARGHEVTVLKYPSIIIDQSKLTPLQFENIPVLYETEVAENHLNEIVNLA-- 96

  Fly    98 TEHTPTRSLGVLIREYVDLHEEGQKTCEHLFASG-HIERAIERHRNKPYDLLLTEYFNSDCQLAL 161
            ....|..||....|...|...:.....|.|..|. :.:..:.:.|:..||:::.:.. ..|...:
  Rat    97 VNVIPNLSLWEAARTLQDFFLQLTGNFEDLCRSTLYNQTLMNKLRDAKYDVMVLDPV-IPCGELV 160

  Fly   162 AKLLNLPII-------GLST---CALMPYYYDRIDLPDTPAFIQSEFVGFAGQLNWH----ERLL 212
            |::|.:|.:       |.|.   |..:|     :.|...|..:        |:|..|    ||:.
  Rat   161 AEVLQIPFVNTLRFSMGYSMEKYCGQLP-----VPLSYVPVVM--------GELTDHMTFTERVK 212

  Fly   213 NFVQAKLLKFLYKYHSNRADNELVRKYLGVEVD-VEEVARTQTAFIFGNQHYSLMGSRPQSLQFV 276
            |.:.:...:|..:.:.....::...|.||.... .:.|.:.:...|  ..::.:...||....|.
  Rat   213 NMMLSLFFEFWLQQYDFAFWDQFYSKTLGRPTTFCKTVGKAEIWLI--RTYWDIEFPRPYLPNFE 275

  Fly   277 EIGGVHITKKAEQELPQNIANFLNQSAE-GVIFISWGSMVRASSIDEDKLSAILEVLKSQPLKII 340
            .:||:|.  |..:.||:.:..|:..|.| ||:..|.|||::  ::.|:|.:.|...|...|.|::
  Rat   276 FVGGLHC--KPAKPLPKELEEFVQSSGEHGVVVFSLGSMIK--NLTEEKANLIASALAQIPQKVL 336

  Fly   341 WKWEADETPDTDASKFLFVKWAPQLALLCHPKVKLFWSHGGLLGTTESVHCGKPLLVTPIYGDQF 405
            |:: :.:.|.|.......:.|.||..||.|||.:.|.:|||..|..|:::.|.|::..|::|||.
  Rat   337 WRY-SGKKPATLGPNTRILNWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGVPMVGIPMFGDQP 400

  Fly   406 LNAFSVQNRGMGLKLDYQDITVPNLKKAL-AELSKNSYAQRSLEVSKVFNERQQTPLESAIWSVE 469
            .|...::.:|..:|:....:|..:|..|| |.:::.||.:.::.:|:|.:::...||:.|::.:|
  Rat   401 YNIAHMEAKGAAVKVAINTMTSADLLSALRAVINEPSYKENAMRLSRVHHDQPVKPLDRAVFWIE 465

  Fly   470 HVISNGLIAARLLQSPGIELNGFVYHSLDSVALILLPLILLILVL--C--YLCKRNPSKLAHKKV 530
            .|:.:.  .|:.|:....:|:.|.|||||.:..:|:.::.|..|:  |  ::|::...:...||.
  Rat   466 FVMRHK--GAKHLRVAAHDLSWFQYHSLDVIGFLLVCVVTLTFVITKCSLFMCRKCCLRERKKKG 528

  Fly   531 GKKPK 535
            .:|.|
  Rat   529 NRKKK 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 117/459 (25%)
UDPGT 38..501 CDD:278624 126/485 (26%)
Ugt2a3NP_001129341.1 UDPGT 25..519 CDD:278624 131/509 (26%)
egt <268..506 CDD:223071 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343981
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.