DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt36A1 and UGT2B11

DIOPT Version :9

Sequence 1:NP_001285591.1 Gene:Ugt36A1 / 44058 FlyBaseID:FBgn0015663 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001064.1 Gene:UGT2B11 / 10720 HGNCID:12545 Length:529 Species:Homo sapiens


Alignment Length:547 Identity:127/547 - (23%)
Similarity:246/547 - (44%) Gaps:75/547 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAGNILAVYPHFGFSHFKVVMPILNELAHRGHDITVI----SYVKNPQAGAYPNYEELLISAPGE 85
            |.|.:|.....  :||:..:..||.||..|||::||:    |.:.:|                 .
Human    22 SCGKVLVWAAE--YSHWMNMKTILKELVQRGHEVTVLASSASILFDP-----------------N 67

  Fly    86 DQSSTTINLVPLTEHTPTRSLGVL---IREYVDLHEEG-------------------QKTCEHLF 128
            |.|:....:.| |..|.|....::   ::.:.|:.::.                   :..|:.:.
Human    68 DASTLKFEVYP-TSLTKTEFENIIMQQVKRWSDIRKDSFWLYFSQEQEILWELYDIFRNFCKDVV 131

  Fly   129 ASGHIERAIERHRNKPYDLLLTEYFNSDCQLALAKLLNLPIIGLSTCALMP-YYYDR----IDLP 188
            ::..:.:.::..|   :|::..:.. ..|...||.|||:..:  .:....| |..:|    :..|
Human   132 SNKKVMKKLQESR---FDIVFADAV-FPCGELLAALLNIRFV--YSLRFTPGYTIERHSGGLIFP 190

  Fly   189 DTPAFIQSEFVGFAGQLNWHERLLNFVQAKLLKFLYKYHSNRADNELVRKYLGVEVDVEEVARTQ 253
              |::|.......:.|:.:.||:.|.:......|.::....:..::...:.||....:.|.....
Human   191 --PSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMSDMKKWDQFYSEVLGRPTTLFETMGKA 253

  Fly   254 TAFIFGNQHYSLMGSRP--QSLQFVEIGGVHITKKAEQELPQNIANFLNQSAE-GVIFISWGSMV 315
            ..::..|. :|.....|  .::.||  ||.|.  |..:.||:.:..|:..|.| ||:..|.||::
Human   254 DIWLMRNS-WSFQFPHPFLPNVDFV--GGFHC--KPAKPLPKEMEEFVQSSGENGVVVFSLGSVI 313

  Fly   316 RASSIDEDKLSAILEVLKSQPLKIIWKWEADETPDTDASKFLFVKWAPQLALLCHPKVKLFWSHG 380
              |::..::.:.|...|...|.|::|:::.:: ||.........||.||..||.|||.:.|.:||
Human   314 --SNMTAERANVIATALAKIPQKVLWRFDGNK-PDALGLNTRLYKWIPQNDLLGHPKTRAFITHG 375

  Fly   381 GLLGTTESVHCGKPLLVTPIYGDQFLNAFSVQNRGMGLKLDYQDITVPNLKKALAELSKNS-YAQ 444
            |..|..|:::.|.|::..|::.||..|...::.:|..::||:..::..:|..||..:..:. |.:
Human   376 GANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRLDFNTMSSTDLLNALKTVINDPLYKE 440

  Fly   445 RSLEVSKVFNERQQTPLESAIWSVEHVISNGLIAARLLQSPGIELNGFVYHSLDSVALILLPLIL 509
            ..:::|::.:::...||:.|::.:|.|:.:.  .|:.|:....:|..|.|||||.:..:|..:..
Human   441 NIMKLSRIQHDQPVKPLDRAVFWIEFVMPHK--GAKHLRVAAHDLTWFQYHSLDVIGFLLACVAT 503

  Fly   510 LILVLCYLCKRNPSKLAHKKVGKKPKR 536
            :|.::...|.....|.|.|  |||.||
Human   504 VIFIITKFCLFCFWKFARK--GKKGKR 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt36A1NP_001285591.1 egt 8..475 CDD:223071 107/484 (22%)
UDPGT 38..501 CDD:278624 113/497 (23%)
UGT2B11NP_001064.1 UDPGT 24..525 CDD:278624 122/540 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.