DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc7 and UBC14

DIOPT Version :9

Sequence 1:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001190096.1 Gene:UBC14 / 824704 AraportID:AT3G55380 Length:201 Species:Arabidopsis thaliana


Alignment Length:188 Identity:80/188 - (42%)
Similarity:109/188 - (57%) Gaps:34/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPPKMKF 73
            |..:.|.|...|.:|..||.:.|.|.|:|...|.||..|.:|||.|.|.:.||.:||:|||.:.|
plant    10 LQKQLKDLCKKPVDGFSAGLVDEKNVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPPTVTF 74

  Fly    74 TCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSV---------------------- 116
            |.:|:|||:::||:|||||||.|||||.||||::|||:||.::                      
plant    75 TSEMWHPNVYSDGKVCISILHPPGDDPHGYELASERWTPVHTLVETDMFCSILSLYSDCFSNVRG 139

  Fly   117 ------------EKILLSVVSMLAEPNDESGANVDAAIMWREQRDEFNAIARRLVRKT 162
                        :.|:||::|||:.|||||.|||:||..||:.|.||.....|.||::
plant   140 IYKSGLRNTLEDKSIVLSIISMLSGPNDESPANVEAAKEWRDNRAEFRKKVSRCVRRS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 80/188 (43%)
UQ_con 8..159 CDD:278603 78/183 (43%)
UBC14NP_001190096.1 COG5078 19..197 CDD:227410 77/177 (44%)
UQ_con 19..194 CDD:278603 75/174 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.980

Return to query results.
Submit another query.