DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc7 and UBE2G2

DIOPT Version :9

Sequence 1:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_003334.2 Gene:UBE2G2 / 7327 HGNCID:12483 Length:165 Species:Homo sapiens


Alignment Length:165 Identity:135/165 - (81%)
Similarity:153/165 - (92%) Gaps:0/165 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGSALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYP 65
            |||:||:|||||||||||:|||||||||::|:|||||||||.|||.||||.|||||.|.||.|||
Human     1 MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYP 65

  Fly    66 LSPPKMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEP 130
            ||||||:|||:||||||:.||||||||||||||||||||.|||||||||||||||||||||||||
Human    66 LSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEP 130

  Fly   131 NDESGANVDAAIMWREQRDEFNAIARRLVRKTLGL 165
            ||||||||||:.|||:.|::|..||:::|:|:|||
Human   131 NDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 132/161 (82%)
UQ_con 8..159 CDD:278603 125/150 (83%)
UBE2G2NP_003334.2 COG5078 1..163 CDD:227410 132/161 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160526
Domainoid 1 1.000 266 1.000 Domainoid score I1890
eggNOG 1 0.900 - - E1_KOG0426
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6599
Inparanoid 1 1.050 287 1.000 Inparanoid score I2853
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55907
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 1 1.000 - - FOG0005708
OrthoInspector 1 1.000 - - oto91139
orthoMCL 1 0.900 - - OOG6_105061
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1585
SonicParanoid 1 1.000 - - X4106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.