DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc7 and Ube2g1

DIOPT Version :9

Sequence 1:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_080261.2 Gene:Ube2g1 / 67128 MGIID:1914378 Length:170 Species:Mus musculus


Alignment Length:158 Identity:87/158 - (55%)
Similarity:109/158 - (68%) Gaps:4/158 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPPK 70
            |||.:||   |..:|.||..||.|.:::.:.||.||.||..|.:|||||.|.|.||.||||.|||
Mouse    10 LRRQLAE---LNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPK 71

  Fly    71 MKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEPNDESG 135
            |||..:::|||:..:|.|||||||.||:|..|||...|||.|:.:||.|::||:||||:||.:|.
Mouse    72 MKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSP 136

  Fly   136 ANVDAAIMWREQRD-EFNAIARRLVRKT 162
            ||||||..|||.|: ||.....|.|||:
Mouse   137 ANVDAAKEWREDRNGEFKRKVARCVRKS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 87/158 (55%)
UQ_con 8..159 CDD:278603 82/151 (54%)
Ube2g1NP_080261.2 UQ_con 10..161 CDD:395127 84/153 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.