DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc7 and CG14739

DIOPT Version :9

Sequence 1:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:175 Identity:48/175 - (27%)
Similarity:75/175 - (42%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGSAL----RRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFP 61
            |||..|    .||:|...:.|:|            |:.......:.||.|:.:|||::...:..|
  Fly    13 MAGRRLDRDVNRLLASGYRTTVD------------DDMTNLNVCLEGPLGSAYEGGIWTVNVTMP 65

  Fly    62 TDYPLSPPKMKFTCDMFHPNI-FADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVV- 124
            .||||:.|:::|...:.|||| |..|.||:::|             .:.||....:..|..:.: 
  Fly    66 QDYPLTAPRVRFVTKILHPNIEFITGLVCMNVL-------------KQAWSSSYDLVNIFETFLP 117

  Fly   125 SMLAEPNDESGANVDAAIMWREQRDEF--NAIARRLVRKTLGLPA 167
            .:|..||.....|..||.:.:.....|  :.|   |..||..:||
  Fly   118 QLLRYPNPHDSLNHRAAAIMKHSEQLFREHVI---LCMKTYAMPA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 45/169 (27%)
UQ_con 8..159 CDD:278603 39/154 (25%)
CG14739NP_650151.1 COG5078 12..157 CDD:227410 46/171 (27%)
UQ_con 17..152 CDD:278603 41/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.