DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc7 and Uev1A

DIOPT Version :9

Sequence 1:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:140 Identity:31/140 - (22%)
Similarity:58/140 - (41%) Gaps:25/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLMAEYKQLTLDPPEGIVAGPISEDN---FFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPP 69
            ||:.|..|......:|.::..:..|:   ...|..:|.||..|.||..::..::.....||..||
  Fly    16 RLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPP 80

  Fly    70 KMKFTCDMFHPNIFADGRVCISILHAPGD--DPMGYELSAERWS-------PVQSVEKILLSVVS 125
            .::|..           :|.|:.::....  |....::.| |||       .:|.:.:|:....:
  Fly    81 TLRFIT-----------KVNINCINQNNGVVDHRSVQMLA-RWSREYNIKTMLQEIRRIMTMKEN 133

  Fly   126 M-LAEPNDES 134
            : ||:|.:.|
  Fly   134 LKLAQPPEGS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 31/140 (22%)
UQ_con 8..159 CDD:278603 31/140 (22%)
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.