DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc7 and CG16894

DIOPT Version :9

Sequence 1:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:159 Identity:34/159 - (21%)
Similarity:63/159 - (39%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYP--LSPPKM 71
            ::||| .|..:..:.|.|.| |......|..:|....| .:.|.||...::.|.::|  :|.|.:
  Fly    20 ILAEY-NLVKEELKNIYAIP-SYACGLHWFGVIFVHSG-IYAGSVFRFSILLPENFPADISLPTV 81

  Fly    72 KFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAER------WSPVQSVEKILLSVVSMLAEP 130
            .|:.::.||:|....:. :.:.|.         |:..|      |..::.::.|.......:...
  Fly    82 VFSTEVLHPHICPQNKT-LDLAHF---------LNEWRKDEHHIWHVLRYIQAIFADPEGSICTG 136

  Fly   131 NDESG--------ANVDAAIMWREQRDEF 151
            ...||        .|::|..|..:.|.|:
  Fly   137 QSSSGDLVIMDEVRNMNALNMLAKSRPEY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 34/159 (21%)
UQ_con 8..159 CDD:278603 34/159 (21%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 34/159 (21%)
UBCc 23..173 CDD:294101 33/156 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.