DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc7 and Kua

DIOPT Version :9

Sequence 1:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster


Alignment Length:80 Identity:19/80 - (23%)
Similarity:31/80 - (38%) Gaps:16/80 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DPPEGIVAGPISED-NFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPPKMKFTCDMFHPNI 82
            |.|.|.:|...::| ...:.|.|...|.||........|.|:  :..|...|:.|          
  Fly    17 DDPNGNLAPATTKDKESVKPEELKVTPAGTKATSPPNSATLV--STSPRWGPQNK---------- 69

  Fly    83 FADGRVCISILHAPG 97
               |...:::|::||
  Fly    70 ---GAQELALLYSPG 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 19/80 (24%)
UQ_con 8..159 CDD:278603 19/80 (24%)
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.