DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc7 and CG8188

DIOPT Version :9

Sequence 1:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster


Alignment Length:158 Identity:52/158 - (32%)
Similarity:87/158 - (55%) Gaps:14/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAGSALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYP 65
            ::...:|::|.|.:::...|||||.. .|:|.:..:.:|||.||.||.:..|:|..:|....|:|
  Fly    11 LSPQTIRQVMRELQEMETTPPEGIKV-LINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFP 74

  Fly    66 LSPPKMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEP 130
            |:|||..|...:||||:.|:|.:|::.|             .:.|.|...::.|||::..:|..|
  Fly    75 LTPPKAYFLTKIFHPNVAANGEICVNTL-------------KKDWKPDLGIKHILLTIKCLLIVP 126

  Fly   131 NDESGANVDAAIMWREQRDEFNAIARRL 158
            |.||..|.:|..|..|:.|:::..||.:
  Fly   127 NPESALNEEAGKMLLERYDDYSQRARMM 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 52/158 (33%)
UQ_con 8..159 CDD:278603 51/151 (34%)
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 52/157 (33%)
UBCc 16..155 CDD:238117 52/153 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.