DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc7 and ubc7

DIOPT Version :9

Sequence 1:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_595778.1 Gene:ubc7 / 2541252 PomBaseID:SPBP16F5.04 Length:166 Species:Schizosaccharomyces pombe


Alignment Length:161 Identity:114/161 - (70%)
Similarity:134/161 - (83%) Gaps:0/161 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPP 69
            ||||||.|||:||.:.|:||.|||.:||:||.|:.||.||:||.||||::||.|.||:||||.||
pombe     6 ALRRLMKEYKELTENGPDGITAGPSNEDDFFTWDCLIQGPDGTPFEGGLYPATLKFPSDYPLGPP 70

  Fly    70 KMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEPNDES 134
            .:||.|:.||||::.||.|||||||||||||..||.|:||||||||||||||||:||||||||||
pombe    71 TLKFECEFFHPNVYKDGTVCISILHAPGDDPNMYESSSERWSPVQSVEKILLSVMSMLAEPNDES 135

  Fly   135 GANVDAAIMWREQRDEFNAIARRLVRKTLGL 165
            |||:||..||||.|:|:..:.|||.||||||
pombe   136 GANIDACKMWREDREEYCRVVRRLARKTLGL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 110/157 (70%)
UQ_con 8..159 CDD:278603 104/150 (69%)
ubc7NP_595778.1 COG5078 1..164 CDD:227410 110/157 (70%)
UQ_con 9..160 CDD:278603 104/150 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 229 1.000 Domainoid score I511
eggNOG 1 0.900 - - E1_KOG0426
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6599
Inparanoid 1 1.050 247 1.000 Inparanoid score I798
OMA 1 1.010 - - QHG55907
OrthoFinder 1 1.000 - - FOG0005708
OrthoInspector 1 1.000 - - oto101850
orthoMCL 1 0.900 - - OOG6_105061
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1585
SonicParanoid 1 1.000 - - X4106
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.