DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSG8 and side-VII

DIOPT Version :9

Sequence 1:NP_874366.1 Gene:PSG8 / 440533 HGNCID:9525 Length:426 Species:Homo sapiens
Sequence 2:NP_001262432.1 Gene:side-VII / 41184 FlyBaseID:FBgn0037736 Length:939 Species:Drosophila melanogaster


Alignment Length:448 Identity:110/448 - (24%)
Similarity:163/448 - (36%) Gaps:105/448 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    25 LNFWNPPTTAQVTIE-----AQPTKV---SEGKDVLLLVHNLPQNLTGY-----IWYKGQIR--- 73
            ||..:||  .||.|.     .:.|.|   |||..|.|..    |.:.||     .||:..|.   
  Fly   132 LNVISPP--KQVIIRDSSNVERSTVVGPYSEGDIVSLKC----QVIGGYPTPTISWYRDGIEIPC 190

Human    74 DLYHYITSYVVDGQIIIYGPAYSGRETIYSNASL---------LIQNVTQEDAGSYTLHI-IMGG 128
            :|.|.....:::.:|.:  |:. |||.:.|..:.         :::.|.|.|.....|:| ::|.
  Fly   191 ELSHLAGGKIIECEITL--PSL-GREDLNSRLTCRALSHPRAPIVEAVVQIDMNFAPLNIRLLGA 252

Human   129 DENRGVTGHFTFTLYLETPKPSISSSKLNPREAMEAVSLTCDP--ETPDASYLWWMNGQSLPMSH 191
            .:                           |..|.....|.|..  ..|.|...||.||..|..:.
  Fly   253 HQ---------------------------PLSAGRRYDLLCQSAGSRPPAVITWWQNGIRLEKTT 290

Human   192 RLQLSETNRTLFLLGV--TKYTAGPY-ECEIRNPVSASR--SDPFTLNLLPKLPKPYITI-NNLK 250
            ....|:.|:|...|.:  :|..||.| .|:..|....|.  .|.:.|: :..:|:.|:.: .:|.
  Fly   291 ETTSSDGNQTTSTLSISLSKSDAGKYLSCKAYNHAVPSEPLEDGWKLD-IQYVPEAYVRLGTSLD 354

Human   251 P---RENKDVLNFTCEPKSE-NYTYIWWLNGQSLPVSPRVKRP--IENRILILPSVTRNETGPYQ 309
            |   ||..||. |.|...:. |...|.|.:.:. |:|..:...  |.|..|:|..|||...|.|.
  Fly   355 PSTLREGTDVY-FDCLVMAHPNVFRIEWRHNEQ-PLSHNISLGVIISNHSLVLQGVTRATAGNYS 417

Human   310 CEIRDQYGGIRSYPVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNP-PAQYSWTINGKFQ 373
            |...:..|...|.|..||:||.|...:...........|...:.|:.|:|| ..::|||.|...:
  Fly   418 CVGFNAEGEGISAPFALNILYAPTCAQNQKKVYGIAKQEDAKVMCTVDANPREVEFSWTFNNSAE 482

Human   374 ----------LSGQKLFI--PQITTKHSGLYACSVRNSATGKESSKSMTVKVSGKRIP 419
                      .||....:  ..||....|...|...|             |:..:|:|
  Fly   483 SIDVATNHIIRSGTTSIVTYTPITELDYGTLLCLASN-------------KIGKQRVP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSG8NP_874366.1 Ig_CEACAM_D1 36..138 CDD:319315 29/127 (23%)
Ig 148..236 CDD:325142 24/94 (26%)
Ig 241..329 CDD:325142 29/94 (31%)
Ig_2 335..413 CDD:316418 16/90 (18%)
side-VIINP_001262432.1 IG_like 32..134 CDD:214653 1/1 (100%)
V-set 32..134 CDD:284989 1/1 (100%)
IGc2 160..>214 CDD:197706 16/60 (27%)
Ig 262..328 CDD:299845 19/65 (29%)
IG_like 264..323 CDD:214653 18/58 (31%)
IGc2 360..425 CDD:197706 20/66 (30%)
Ig_3 456..519 CDD:290638 15/62 (24%)
FN3 538..620 CDD:238020
FAM176 643..741 CDD:291517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.