DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PSG8 and Ceacam2

DIOPT Version :9

Sequence 1:NP_874366.1 Gene:PSG8 / 440533 HGNCID:9525 Length:426 Species:Homo sapiens
Sequence 2:NP_001106839.1 Gene:Ceacam2 / 26367 MGIID:1347246 Length:520 Species:Mus musculus


Alignment Length:416 Identity:164/416 - (39%)
Similarity:205/416 - (49%) Gaps:101/416 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGLLSAPPCTQRITWKGLLLTASLLNFWNPPTTAQVTIEAQPTKVSEGKDVLLLVHNLPQNLTGY 65
            |.|.||.....::.|.|||||||||..|:||||||||:.|.|...:||.:|:|:|:|:.:.::.:
Mouse     1 MELASAHLHKGQVPWFGLLLTASLLASWSPPTTAQVTVMAFPLHAAEGNNVILVVYNMMKGVSAF 65

Human    66 IWYKGQIRDLYHYITSYVVDGQIIIYGPAYSGRETIYSNASLLIQNVTQEDAGSYTLHIIMGGDE 130
            .|:||........|..:|......|.||.:|||||:|||.|||||.||.:|.|.||:.:......
Mouse    66 SWHKGSTTSTNAEIVRFVTGTNKTIKGPVHSGRETLYSNGSLLIQRVTMKDTGVYTIEMTDQNYR 130

Human   131 NRGVTGHF-TFTLYLETPKPSISSSKLNPREAMEAVSLTCDPET-PD-ASYLWWMNGQSLPMSHR 192
            .|.:||.| ..||.|   |.:|:|:..||.|..::||||||..| || .:|||..||:||....|
Mouse   131 RRVLTGQFHVHTLLL---KSNITSNNSNPVEGDDSVSLTCDSYTDPDNITYLWSRNGESLSEGDR 192

Human   193 LQLSETNRTLFLLGVTKYTAGPYECEIRNPVSASRSDPFTLNLLPKLPKPYITINNLKPRENKDV 257
            |:|||.||||.||.||:...|||.||.|||||.:|||||                          
Mouse   193 LKLSEGNRTLTLLNVTRNDTGPYVCETRNPVSVNRSDPF-------------------------- 231

Human   258 LNFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYQCEIRDQYGGIRSY 322
                                                                             
Mouse   232 ----------------------------------------------------------------- 231

Human   323 PVTLNVLYGPDLPRIYPSFTYYRSGEVLYLSCSADSNPPAQYSWTINGKFQLSGQKLFIPQITTK 387
              :||::||||.|.|.||..|...|..|.|||.|.|||||||.|.||.|...|.|:||||.|||.
Mouse   232 --SLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTN 294

Human   388 HSGLYACSVRNSATG--KESSKSMTV 411
            :||.|.|.|.||.||  :.:.|::||
Mouse   295 NSGTYTCFVNNSVTGLSRTTVKNITV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PSG8NP_874366.1 Ig_CEACAM_D1 36..138 CDD:319315 40/101 (40%)
Ig 148..236 CDD:325142 50/89 (56%)
Ig 241..329 CDD:325142 2/87 (2%)
Ig_2 335..413 CDD:316418 43/79 (54%)
Ceacam2NP_001106839.1 Ig_CEACAM_D1 36..140 CDD:143251 41/103 (40%)
Ig 146..235 CDD:299845 51/181 (28%)
IG_like 157..221 CDD:214653 35/63 (56%)
Ig_2 242..320 CDD:290606 41/77 (53%)
IG_like 246..320 CDD:214653 39/73 (53%)
Ig 322..412 CDD:299845
IG_like 333..412 CDD:214653
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 457..520
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83965293
Domainoid 1 1.000 96 1.000 Domainoid score I46009
eggNOG 1 0.900 - - E1_29WEF
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D241176at32523
OrthoFinder 1 1.000 - - FOG0000658
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44427
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X34
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.