Sequence 1: | NP_524683.2 | Gene: | Shc / 44052 | FlyBaseID: | FBgn0015296 | Length: | 409 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001358940.1 | Gene: | SHD / 56961 | HGNCID: | 30633 | Length: | 340 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 46/206 - (22%) |
---|---|---|---|
Similarity: | 75/206 - (36%) | Gaps: | 55/206 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 213 PPEVPEPQQQQV-QQPLHP-------------HAPRVAQLNLKKPR-DRLSSNLIDLNSPPPDQT 262
Fly 263 TNKLGHFDPLQATTAANSVLPSVRDVFDGPQCPLTAEVWFHAGISRPISERLLQ--QDGDFLVRE 325
Fly 326 SQGKRGQYVLTGLEGKTPKHLLLIDPEGVVRTKDR---------IFDSISHLINYHWAHALPIIS 381
Fly 382 EDSELVLRNPV 392 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Shc | NP_524683.2 | PTB_Shc | 19..178 | CDD:269920 | |
SH2_SHC | 293..396 | CDD:198179 | 28/111 (25%) | ||
SHD | NP_001358940.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..77 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 94..186 | 6/26 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 198..230 | 9/53 (17%) | |||
SH2_SHD | 238..335 | CDD:198253 | 24/103 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |