DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shc and SHD

DIOPT Version :9

Sequence 1:NP_524683.2 Gene:Shc / 44052 FlyBaseID:FBgn0015296 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001358940.1 Gene:SHD / 56961 HGNCID:30633 Length:340 Species:Homo sapiens


Alignment Length:206 Identity:46/206 - (22%)
Similarity:75/206 - (36%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 PPEVPEPQQQQV-QQPLHP-------------HAPRVAQLNLKKPR-DRLSSNLIDLNSPPPDQT 262
            ||...:|:|.:: |:...|             |..|...:....|. :|...:..:|..|||   
Human   159 PPSGQKPRQSRMPQEDERPADEYDQPWEWKKDHISRAFAVQFDSPEWERTPGSAKELRRPPP--- 220

  Fly   263 TNKLGHFDPLQATTAANSVLPSVRDVFDGPQCPLTAEVWFHAGISRPISERLLQ--QDGDFLVRE 325
                            .|..|:.|   ..|..||..:.|||..::|..:|.||.  ::|.:|||.
Human   221 ----------------RSPQPAER---VDPALPLEKQPWFHGPLNRADAESLLSLCKEGSYLVRL 266

  Fly   326 SQGKRGQYVLTGLEGKTPKHLLLIDPEGVVRTKDR---------IFDSISHLINYHWAHALPIIS 381
            |:.......|:....:...||..      .||::.         .|.|:..|:.::.:..||:..
Human   267 SETNPQDCSLSLRSSQGFLHLKF------ARTRENQVVLGQHSGPFPSVPELVLHYSSRPLPVQG 325

  Fly   382 EDSELVLRNPV 392
            .: .|.|..||
Human   326 AE-HLALLYPV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShcNP_524683.2 PTB_Shc 19..178 CDD:269920
SH2_SHC 293..396 CDD:198179 28/111 (25%)
SHDNP_001358940.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..186 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..230 9/53 (17%)
SH2_SHD 238..335 CDD:198253 24/103 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.