DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shc and C25A8.5

DIOPT Version :9

Sequence 1:NP_524683.2 Gene:Shc / 44052 FlyBaseID:FBgn0015296 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_501081.1 Gene:C25A8.5 / 182879 WormBaseID:WBGene00016085 Length:416 Species:Caenorhabditis elegans


Alignment Length:106 Identity:32/106 - (30%)
Similarity:58/106 - (54%) Gaps:12/106 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 LTAEVWFHAGISRPISERLLQQDGDFLVRESQGKRG---QYVLTG-----LEGKTPKHLLL-IDP 351
            :.:|.|:|..:.|...:.:|:::||||||.::.|.|   ||||:.     ||....||.:: ::|
 Worm     6 IPSEPWYHGLLPREDIKAMLRKNGDFLVRSTEPKAGEPRQYVLSAMQSEELEDAGVKHYVMRLNP 70

  Fly   352 EGVVRTKDRIFDSISHLINYHWAHALPIISEDSELVLRNPV 392
            ...:..:.:.|::|:.|:||:.....||   ....||:.|:
 Worm    71 SNQIFLEAKGFETIASLVNYYMNSKEPI---KKMTVLKTPI 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShcNP_524683.2 PTB_Shc 19..178 CDD:269920
SH2_SHC 293..396 CDD:198179 32/106 (30%)
C25A8.5NP_501081.1 SH2_Fps_family 4..98 CDD:198224 27/91 (30%)
TyrKc 120..374 CDD:197581
PTKc 124..375 CDD:270623
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861654 Normalized mean entropy S5640
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.