DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sun and ATP15

DIOPT Version :9

Sequence 1:NP_524682.1 Gene:sun / 44046 FlyBaseID:FBgn0014391 Length:61 Species:Drosophila melanogaster
Sequence 2:NP_015052.1 Gene:ATP15 / 855857 SGDID:S000006192 Length:62 Species:Saccharomyces cerevisiae


Alignment Length:58 Identity:25/58 - (43%)
Similarity:34/58 - (58%) Gaps:1/58 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAWRAAGITYIQYSNIAARILRESLKTGLR-ADAAKRDASHVKFTPWANGKPAQRQT 57
            |:|||.|||:|..|.|:||:.:|.||||.|: |....|..:...:|.:.||..|...|
Yeast     1 MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPT 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunNP_524682.1 ATP-synt_Eps 2..50 CDD:398354 20/48 (42%)
ATP15NP_015052.1 ATP-synt_Eps 2..51 CDD:398354 20/48 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I3136
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I1863
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - otm46585
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - LDO PTHR12448
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.