DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sun and AT1G51650

DIOPT Version :9

Sequence 1:NP_524682.1 Gene:sun / 44046 FlyBaseID:FBgn0014391 Length:61 Species:Drosophila melanogaster
Sequence 2:NP_175576.1 Gene:AT1G51650 / 841590 AraportID:AT1G51650 Length:70 Species:Arabidopsis thaliana


Alignment Length:58 Identity:27/58 - (46%)
Similarity:38/58 - (65%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGKPAQRQTQSES 61
            |||||:|||.||||.|.|:|..||...:|:|..|:..|...:.||:|||.:...:|::
plant    10 WRAAGMTYISYSNICANIVRNCLKEPHKAEALTREKVHFSLSKWADGKPQKPVLRSDT 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunNP_524682.1 ATP-synt_Eps 2..50 CDD:398354 23/45 (51%)
AT1G51650NP_175576.1 ATP-synt_Eps 8..56 CDD:398354 23/45 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4155
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2556
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628103at2759
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - otm3013
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - O PTHR12448
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.