DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sun and Atp5e

DIOPT Version :9

Sequence 1:NP_524682.1 Gene:sun / 44046 FlyBaseID:FBgn0014391 Length:61 Species:Drosophila melanogaster
Sequence 2:NP_080259.1 Gene:Atp5e / 67126 MGIID:1855697 Length:52 Species:Mus musculus


Alignment Length:40 Identity:18/40 - (45%)
Similarity:29/40 - (72%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVK 43
            ||.||::||::|.|.|:.:|::|||..:|:|.|...|.:|
Mouse     5 WRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGSSIK 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunNP_524682.1 ATP-synt_Eps 2..50 CDD:398354 18/40 (45%)
Atp5eNP_080259.1 ATP-synt_Eps 3..47 CDD:309668 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12235
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5493
Isobase 1 0.950 - 0 Normalized mean entropy S5979
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - otm42658
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - LDO PTHR12448
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.