| Sequence 1: | NP_524682.1 | Gene: | sun / 44046 | FlyBaseID: | FBgn0014391 | Length: | 61 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_008817.1 | Gene: | ATP5F1E / 514 | HGNCID: | 838 | Length: | 51 | Species: | Homo sapiens |
| Alignment Length: | 40 | Identity: | 20/40 - (50%) |
|---|---|---|---|
| Similarity: | 30/40 - (75%) | Gaps: | 0/40 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 WRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVK 43 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sun | NP_524682.1 | ATP-synt_Eps | 2..50 | CDD:398354 | 20/40 (50%) |
| ATP5F1E | NP_008817.1 | ATP-synt_Eps | 3..50 | CDD:282481 | 20/40 (50%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 47 | 1.000 | Domainoid score | I12007 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3495 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 47 | 1.000 | Inparanoid score | I5490 |
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S5979 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1628103at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0002155 | |
| OrthoInspector | 1 | 1.000 | - | - | mtm8507 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_103560 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR12448 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 12 | 11.780 | |||||