DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sun and atp15

DIOPT Version :9

Sequence 1:NP_524682.1 Gene:sun / 44046 FlyBaseID:FBgn0014391 Length:61 Species:Drosophila melanogaster
Sequence 2:NP_596577.1 Gene:atp15 / 2540229 PomBaseID:SPBC31F10.15c Length:67 Species:Schizosaccharomyces pombe


Alignment Length:57 Identity:16/57 - (28%)
Similarity:33/57 - (57%) Gaps:3/57 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGKPAQRQTQS 59
            ||: ...:|.:|::|.::.:|::||..::.:......:...:|.|.||  ||.:|:|
pombe     4 AWK-KNFSYSKYASICSQTVRQALKPEIKNEVKTHGDAEFLYTRWKNG--AQEKTES 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunNP_524682.1 ATP-synt_Eps 2..50 CDD:398354 10/46 (22%)
atp15NP_596577.1 ATP-synt_Eps 3..50 CDD:282481 10/46 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - LDO PTHR12448
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.860

Return to query results.
Submit another query.