Sequence 1: | NP_524682.1 | Gene: | sun / 44046 | FlyBaseID: | FBgn0014391 | Length: | 61 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_504198.1 | Gene: | hpo-18 / 178830 | WormBaseID: | WBGene00017982 | Length: | 54 | Species: | Caenorhabditis elegans |
Alignment Length: | 52 | Identity: | 26/52 - (50%) |
---|---|---|---|
Similarity: | 34/52 - (65%) | Gaps: | 2/52 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTAWRAAGITYIQYSNIAARILRESLK-TGLRADAAKRDASHVKFTPWANGK 51 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sun | NP_524682.1 | ATP-synt_Eps | 2..50 | CDD:398354 | 22/48 (46%) |
hpo-18 | NP_504198.1 | ATP-synt_Eps | 3..50 | CDD:282481 | 22/47 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 47 | 1.000 | Domainoid score | I8090 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3495 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 50 | 1.000 | Inparanoid score | I4104 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628103at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002155 | |
OrthoInspector | 1 | 1.000 | - | - | mtm4741 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_103560 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR12448 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X6481 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
12 | 11.870 |