DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sun and hpo-18

DIOPT Version :9

Sequence 1:NP_524682.1 Gene:sun / 44046 FlyBaseID:FBgn0014391 Length:61 Species:Drosophila melanogaster
Sequence 2:NP_504198.1 Gene:hpo-18 / 178830 WormBaseID:WBGene00017982 Length:54 Species:Caenorhabditis elegans


Alignment Length:52 Identity:26/52 - (50%)
Similarity:34/52 - (65%) Gaps:2/52 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAWRAAGITYIQYSNIAARILRESLK-TGLRADAAKRDASHVKFTPWANGK 51
            |.||||||:.|::||.|||.|.|:..| .|.:| |.|:..:.:|.|.|.|||
 Worm     1 MVAWRAAGLNYVRYSQIAAEITRKCTKQVGGKA-AVKKPEATLKITTWENGK 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunNP_524682.1 ATP-synt_Eps 2..50 CDD:398354 22/48 (46%)
hpo-18NP_504198.1 ATP-synt_Eps 3..50 CDD:282481 22/47 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8090
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4104
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628103at2759
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - mtm4741
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - LDO PTHR12448
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6481
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.