Sequence 1: | NP_524682.1 | Gene: | sun / 44046 | FlyBaseID: | FBgn0014391 | Length: | 61 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001380031.1 | Gene: | R05D3.6 / 176178 | WormBaseID: | WBGene00019880 | Length: | 54 | Species: | Caenorhabditis elegans |
Alignment Length: | 51 | Identity: | 23/51 - (45%) |
---|---|---|---|
Similarity: | 33/51 - (64%) | Gaps: | 3/51 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGK 51 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sun | NP_524682.1 | ATP-synt_Eps | 2..50 | CDD:398354 | 19/47 (40%) |
R05D3.6 | NP_001380031.1 | ATP-synt_Eps | 3..47 | CDD:398354 | 19/46 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 47 | 1.000 | Domainoid score | I8090 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3495 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 50 | 1.000 | Inparanoid score | I4104 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628103at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002155 | |
OrthoInspector | 1 | 1.000 | - | - | mtm4741 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_103560 | |
Panther | 1 | 1.100 | - | - | O | PTHR12448 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X6481 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
13 | 12.830 |