DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sun and R05D3.6

DIOPT Version :9

Sequence 1:NP_524682.1 Gene:sun / 44046 FlyBaseID:FBgn0014391 Length:61 Species:Drosophila melanogaster
Sequence 2:NP_001380031.1 Gene:R05D3.6 / 176178 WormBaseID:WBGene00019880 Length:54 Species:Caenorhabditis elegans


Alignment Length:51 Identity:23/51 - (45%)
Similarity:33/51 - (64%) Gaps:3/51 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGK 51
            |.||||||:.|::||.|||:::|:..|.|..   .|:..:.:|.|.|.|||
 Worm     1 MVAWRAAGLNYVRYSQIAAQVVRQCTKGGAN---VKKPQATLKTTAWENGK 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunNP_524682.1 ATP-synt_Eps 2..50 CDD:398354 19/47 (40%)
R05D3.6NP_001380031.1 ATP-synt_Eps 3..47 CDD:398354 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8090
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4104
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628103at2759
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - mtm4741
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - O PTHR12448
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6481
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.