DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and SSK2

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_014428.1 Gene:SSK2 / 855765 SGDID:S000005314 Length:1579 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:92/308 - (29%)
Similarity:159/308 - (51%) Gaps:41/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 SVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNL----SQQPKKELIINEILVMREN 618
            |:.:.:.::.|...||.|..|.||:|::...|..:|:|::|:    |.|....||..|:.|:...
Yeast  1258 SISNVSMRWQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEIL 1322

  Fly   619 KHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAV-CREVLQALEFLHANQVI 682
            .|||:|:|....:..:::.:.|||..||||..::....:::..:..| ..::|:.|.:||.:.::
Yeast  1323 NHPNIVSYYGVEVHRDKVNIFMEYCEGGSLAALLEHGRIEDEMVTQVYTLQLLEGLAYLHESGIV 1387

  Fly   683 HRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTT---------------------------- 719
            |||:|.:||||..:|.:|..|||...:|:...::..:                            
Yeast  1388 HRDVKPENILLDFNGVIKYVDFGAAKKIANNGTRLASMNKIENADGEHEDVTHVSDSKAVKNNEN 1452

  Fly   720 ----MVGTPYWMAPEVVTRKQYGPKV---DLWSLGIMAIEMVEGEPPYLN-ENPLKALYLIATNG 776
                |:|||.:||||.:|......|:   |:||||.:.:||:.|..|:.| :|....:|.:|...
Yeast  1453 ALLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPWANLDNEWAIMYHVAAGH 1517

  Fly   777 KPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLA 824
            .|:...||::|||...||::||.....:||||::||..|::...|.:|
Yeast  1518 TPQFPTKDEVSSAGMKFLERCLIQNPSKRASAVELLMDPWIVQIREIA 1565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 90/300 (30%)
S_TKc 566..817 CDD:214567 89/291 (31%)
SSK2NP_014428.1 STKc_MEKK4 1265..1558 CDD:270796 89/292 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.