DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and STE11

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_013466.1 Gene:STE11 / 851076 SGDID:S000004354 Length:717 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:101/327 - (30%)
Similarity:167/327 - (51%) Gaps:61/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 DEEILEKLRTIVS----VGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNL------- 599
            |.:...:...|||    :..| :.:.|...||.|:.|:||..:.:.||..:|:||:.:       
Yeast   392 DHDFFGEDSDIVSLPTKIATP-KNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGV 455

  Fly   600 -----------------SQQPKKE--------------------LIINEILVMRENKHPNVVNYL 627
                             .||.|.|                    .:.:|:.:::|..|.|:|.| 
Yeast   456 PTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTY- 519

  Fly   628 DSYLVSEE---LWVVMEYLPGGSLTDVVTE-TCMDEGQIAAVCREVLQALEFLHANQVIHRDIKS 688
              |..|:|   |.:.:||:||||::.::.. ...:|..|....|::|..:.:||...:||||||.
Yeast   520 --YGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKG 582

  Fly   689 DNILLGLDGSVKLTDFGFCAQISP---EQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMA 750
            .|||:.:.|.||:||||...::||   :|:||.::.|:.:||:||||.:.....|.|:||.|.:.
Yeast   583 ANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVV 647

  Fly   751 IEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHP 815
            |||..|:.|:.:.:.::|::.|.||..|||  ....:|..::||.:..|::...|.|||:||:||
Yeast   648 IEMFTGKHPFPDFSQMQAIFKIGTNTTPEI--PSWATSEGKNFLRKAFELDYQYRPSALELLQHP 710

  Fly   816 FL 817
            :|
Yeast   711 WL 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 98/315 (31%)
S_TKc 566..817 CDD:214567 95/301 (32%)
STE11NP_013466.1 SAM_Ste11_fungal 20..82 CDD:188933
Ras_bdg_2 121..224 CDD:405528
PKc_like 415..712 CDD:419665 95/301 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.