DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and AT1G79640

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001319419.1 Gene:AT1G79640 / 844303 AraportID:AT1G79640 Length:684 Species:Arabidopsis thaliana


Alignment Length:275 Identity:103/275 - (37%)
Similarity:145/275 - (52%) Gaps:28/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQM----------NLSQQPKKELIINEILVMRENKH 620
            ||..|.||||.|..|:.|:.......||||.:          |:|::.:..::::         |
plant    13 YTLYEFIGQGVSALVHRALCIPFDEVVAIKILDFERDNCDLNNISREAQTMMLVD---------H 68

  Fly   621 PNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMD---EGQIAAVCREVLQALEFLHANQVI 682
            |||:....|::....|||:|.|:.|||...::.....|   |..||.:.||.|:.|::||.:..|
plant    69 PNVLKSHCSFVSDHNLWVIMPYMSGGSCLHILKAAYPDGFEEAIIATILREALKGLDYLHQHGHI 133

  Fly   683 HRDIKSDNILLGLDGSVKLTDFGFCAQI---SPEQSKRTTMVGTPYWMAPEVVTRKQ-YGPKVDL 743
            |||:|:.|||||..|:|||.|||..|.:   ...|..|.|.||||.||||||:.:.. |..|.|:
plant   134 HRDVKAGNILLGARGAVKLGDFGVSACLFDSGDRQRTRNTFVGTPCWMAPEVMEQLHGYDFKADI 198

  Fly   744 WSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIK-EKD-KLSSAFQDFLDQCLEVEVDRRA 806
            ||.||..:|:..|..|:....|:|.|.:...|..|.:. |:| |.|.:|:..:..||..:..:|.
plant   199 WSFGITGLELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKKFSRSFKQMIASCLVKDPSKRP 263

  Fly   807 SALDLLKHPFLKLAR 821
            ||..||||.|.|.||
plant   264 SAKKLLKHSFFKQAR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 100/270 (37%)
S_TKc 566..817 CDD:214567 99/269 (37%)
AT1G79640NP_001319419.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.