DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and AT1G70430

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001323342.1 Gene:AT1G70430 / 843379 AraportID:AT1G70430 Length:609 Species:Arabidopsis thaliana


Alignment Length:283 Identity:102/283 - (36%)
Similarity:150/283 - (53%) Gaps:27/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 RKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQ-QPKKELIINEILVMRENKHPNVVNYL 627
            :.|...|::|:|.|.|||.|...:....||:|.::|.: :...|.|..|:.:|....|||::...
plant    14 KDYELFEEVGEGVSATVYRARCIALNEIVAVKILDLEKCRNDLETIRKEVHIMSLIDHPNLLKAH 78

  Fly   628 DSYLVSEELWVVMEYLPGGS---LTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSD 689
            .|::.|..||:||.|:.|||   |...|....:::..||.:.||||:||.:||....||||:|:.
plant    79 CSFIDSSSLWIVMPYMSGGSCFHLMKSVYPEGLEQPIIATLLREVLKALVYLHRQGHIHRDVKAG 143

  Fly   690 NILLGLDGSVKLTDFGF--CAQISPEQSK-RTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAI 751
            |||:...|.|||.|||.  |...|.|:.: |.|.||||.||||||:      .::|.:....:| 
plant   144 NILIHSKGVVKLGDFGVSACMFDSGERMQTRNTFVGTPCWMAPEVM------QQLDGYDFKYLA- 201

  Fly   752 EMVEGEPPYLNENPLKALYLIATNGKPEIK-EKD-KLSSAFQDFLDQCLEVEVDRRASALDLLKH 814
               .|..|:....|:|.|.:...|..|.:. ::| |.|.:|::.:..||..:..:|.:|..||||
plant   202 ---HGHAPFSKYPPMKVLLMTLQNAPPRLDYDRDKKFSKSFRELIAACLVKDPKKRPTAAKLLKH 263

  Fly   815 PFLKLARP--------LASLTPL 829
            ||.|.||.        |..|:||
plant   264 PFFKHARSTDYLSRKILHGLSPL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 95/262 (36%)
S_TKc 566..817 CDD:214567 94/259 (36%)
AT1G70430NP_001323342.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.