DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and NP2

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001319236.1 Gene:NP2 / 841937 AraportID:AT1G54960 Length:651 Species:Arabidopsis thaliana


Alignment Length:269 Identity:96/269 - (35%)
Similarity:154/269 - (57%) Gaps:15/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   562 PNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQM----NLSQQPKKELII----NEILVMREN 618
            |..::.|.:.||:||.||||..:...:|..:|:||:    |.:.:.|.:..|    .|:.:::..
plant    64 PPIRWRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLITSNCASKEKTQAHIQELEEEVKLLKNL 128

  Fly   619 KHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTE-TCMDEGQIAAVCREVLQALEFLHANQVI 682
            .|||:|.||.:....|.|.:::|::||||::.::.: ....|..:.....::|..||:||.:.::
plant   129 SHPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKFGAFPESVVRTYTNQLLLGLEYLHNHAIM 193

  Fly   683 HRDIKSDNILLGLDGSVKLTDFGFCAQIS--PEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWS 745
            |||||..|||:...|.:||.|||...|::  ...|...:|.||||||||||:.:..:....|:||
plant   194 HRDIKGANILVDNQGCIKLADFGASKQVAELATISGAKSMKGTPYWMAPEVILQTGHSFSADIWS 258

  Fly   746 LGIMAIEMVEGEPPYLNE-NPLKALYLI-ATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASA 808
            :|...||||.|:.|:..: ..:.|::.| .|...|.|  .|.:||...|||.:||:.|.:.|.:|
plant   259 VGCTVIEMVTGKAPWSQQYKEIAAIFHIGTTKSHPPI--PDNISSDANDFLLKCLQQEPNLRPTA 321

  Fly   809 LDLLKHPFL 817
            .:||||||:
plant   322 SELLKHPFV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 96/269 (36%)
S_TKc 566..817 CDD:214567 94/263 (36%)
NP2NP_001319236.1 STKc_MAPKKK 67..330 CDD:270783 94/264 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.