DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and MAPKKK16

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_194419.2 Gene:MAPKKK16 / 828796 AraportID:AT4G26890 Length:444 Species:Arabidopsis thaliana


Alignment Length:261 Identity:90/261 - (34%)
Similarity:148/261 - (56%) Gaps:21/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSY 630
            :|:...||:|::.||..|| ||:|...|:|..:||   ...|:..|..::.....|::|.|:.:.
plant     5 WTRGPIIGRGSTATVSIAI-SSSGELFAVKSADLS---SSSLLQKEQSILSTLSSPHMVKYIGTG 65

  Fly   631 LVSEELWVV----MEYLPGGSLTDVVTET--CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSD 689
            |..|...:|    |||:.||:|.|::..:  .:.|.:|.:..|::|..|.:||...::|.|:||.
plant    66 LTRESNGLVYNILMEYVSGGNLHDLIKNSGGKLPEPEIRSYTRQILNGLVYLHERGIVHCDLKSH 130

  Fly   690 NILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMV 754
            |:|:..:|.:|:.|.| ||: |.::|:   ..|||.:|||||...::.....|:|:||...|||:
plant   131 NVLVEENGVLKIADMG-CAK-SVDKSE---FSGTPAFMAPEVARGEEQRFPADVWALGCTMIEMM 190

  Fly   755 EGEPPY--LNENPLKALYLIATNGK-PEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPF 816
            .|..|:  ||: .:.|:|.|..:|: |.|..  .:|...:|||..||:.:..:|.:..:||||||
plant   191 TGSSPWPELND-VVAAMYKIGFSGESPAIPA--WISDKAKDFLKNCLKEDQKQRWTVEELLKHPF 252

  Fly   817 L 817
            |
plant   253 L 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 90/261 (34%)
S_TKc 566..817 CDD:214567 88/259 (34%)
MAPKKK16NP_194419.2 STKc_MAPKKK 4..253 CDD:270783 88/259 (34%)
S_TKc 5..253 CDD:214567 88/259 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.