DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and AT4G14480

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_193184.1 Gene:AT4G14480 / 827095 AraportID:AT4G14480 Length:487 Species:Arabidopsis thaliana


Alignment Length:281 Identity:113/281 - (40%)
Similarity:151/281 - (53%) Gaps:29/281 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   571 KIGQGASGTVYTAI-ESSTGMEVAIKQMNLSQ-QPKKELIINEILVMRENKHPNVVNYLDSYLVS 633
            |||.|.|.:||.|| .....|.||||.::|.| :...:.:..|...|....|||::|...|:.|.
plant    20 KIGVGVSASVYKAICIPMNSMVVAIKAIDLDQSRADFDSLRRETKTMSLLSHPNILNAYCSFTVD 84

  Fly   634 EELWVVMEYLPGGSLTDVVTETC---MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGL 695
            ..|||||.::..|||..:|:.:.   :.|..|:...:|.|.|:.:||....:|||||:.|||:..
plant    85 RCLWVVMPFMSCGSLHSIVSSSFPSGLPENCISVFLKETLNAISYLHDQGHLHRDIKAGNILVDS 149

  Fly   696 DGSVKLTDFGFCAQI-SPEQS---------KRTTMVGTPYWMAPEVV-TRKQYGPKVDLWSLGIM 749
            ||||||.|||..|.| .|..|         :.|.:.||||||||||| :...||.|.|:||.||.
plant   150 DGSVKLADFGVSASIYEPVTSSSGTTSSSLRLTDIAGTPYWMAPEVVHSHTGYGFKADIWSFGIT 214

  Fly   750 AIEMVEGEPPYLNENPLKAL------------YLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEV 802
            |:|:..|.||..:..|||:|            |.|.|:|..: |...|.|.||::.:..|||.:.
plant   215 ALELAHGRPPLSHLPPLKSLLMKITKRFHFSDYEINTSGSSK-KGNKKFSKAFREMVGLCLEQDP 278

  Fly   803 DRRASALDLLKHPFLKLARPL 823
            .:|.||..||||||.|..:.|
plant   279 TKRPSAEKLLKHPFFKNCKGL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 111/274 (41%)
S_TKc 566..817 CDD:214567 110/273 (40%)
AT4G14480NP_193184.1 STKc_OSR1_SPAK 13..293 CDD:270787 110/273 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.