DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and MEKK1

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_192590.1 Gene:MEKK1 / 826409 AraportID:AT4G08500 Length:608 Species:Arabidopsis thaliana


Alignment Length:428 Identity:116/428 - (27%)
Similarity:197/428 - (46%) Gaps:91/428 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 NSTVSFPVAVP------LPPIVTPASPTPASIESPDL------------YTPEPTVAQVSAGGPS 511
            |:.|:..|.|.      .||::.|    |.:::.|.:            :.|..||.:.|:...|
plant   208 NNVVAVGVGVGGGIKGLRPPVLKP----PPAMKRPPIDHRGSSWDFLTHFAPSETVKRPSSSSSS 268

  Fly   512 SQVAGNQIAVPQAAVAPAATPNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYT--------- 567
            |:...::                  ...|:::...||:..:...:....|....:|         
plant   269 SEDGCDE------------------EEGKEEEAEAEEMGARFIQLGDTADETCSFTTNEGDSSST 315

  Fly   568 -------------------KMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKK-----ELI 608
                               |.:.:|:|:.|:||..| |..|...|:|:::|..|..:     :.:
plant   316 VSNTSPIYPDGGAIITSWQKGQLLGRGSFGSVYEGI-SGDGDFFAVKEVSLLDQGSQAQECIQQL 379

  Fly   609 INEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQAL 673
            ..||.::.:.:|.|:|.|..:......|::.:|.:..|||..:.....:.:..::...|::|..|
plant   380 EGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGL 444

  Fly   674 EFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQ-- 736
            ::||....||||||..|||:..:|:|||.|||. |::|.....::.. |||:||||||:.||.  
plant   445 KYLHDKGFIHRDIKCANILVDANGAVKLADFGL-AKVSKFNDIKSCK-GTPFWMAPEVINRKDSD 507

  Fly   737 -YGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEV 800
             ||...|:||||...:||..|:.||.:..|::||:.|.....||:  .|.||...:.|:.:||:|
plant   508 GYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEV--PDTLSLDARLFILKCLKV 570

  Fly   801 EVDRRASALDLLKHPFLKLARPLASL--------TPLI 830
            ..:.|.:|.:||.|||::  |||.|:        :||:
plant   571 NPEERPTAAELLNHPFVR--RPLPSVGSGGSGSASPLL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 92/295 (31%)
S_TKc 566..817 CDD:214567 90/286 (31%)
MEKK1NP_192590.1 STKc_MEKK1_plant 332..587 CDD:270802 89/259 (34%)
S_TKc 333..587 CDD:214567 89/258 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.