DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pak and MAP4K2

DIOPT Version :9

Sequence 1:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster
Sequence 2:XP_024304397.1 Gene:MAP4K2 / 5871 HGNCID:6864 Length:860 Species:Homo sapiens


Alignment Length:289 Identity:116/289 - (40%)
Similarity:171/289 - (59%) Gaps:6/289 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 VSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHP 621
            ||:.||..::..::::|.|..|.||.|.::.|....|:|.:.|........:..||.::||.:||
Human     7 VSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILRECRHP 71

  Fly   622 NVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRD 685
            |||.|:.|||.::.||:.||:..||||.::...| .::|.|||.||||.|:.|..||:...||||
Human    72 NVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREALKGLHHLHSQGKIHRD 136

  Fly   686 IKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEV--VTRK-QYGPKVDLWSLG 747
            ||..|:||.|.|.|||.|||...:::...:||.:.:||||||||||  |.|| .|....|:|:||
Human   137 IKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAPEVAAVERKGGYNELCDVWALG 201

  Fly   748 IMAIEMVEGEPPYLNENPLKALYLIATNG--KPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALD 810
            |.|||:.|.:||..:.:|::||.|::.:.  .|::::|.:.:..|..||...|.....:|.:|..
Human   202 ITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAEK 266

  Fly   811 LLKHPFLKLARPLASLTPLIMAAKEATKG 839
            ||:|||.....|.|.||.|:..|.:...|
Human   267 LLQHPFTTQQLPRALLTQLLDKASDPHLG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 108/265 (41%)
S_TKc 566..817 CDD:214567 104/256 (41%)
MAP4K2XP_024304397.1 STKc_MAP4K3_like 16..272 CDD:270788 103/255 (40%)
CNH 528..840 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.